• Featured Product
  • KD/KO Validated

Beta Actin Polyclonal antibody

Beta Actin Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 20536-1-AP
Publications(5149)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, canine, monkey and More (7)

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

ACTB, Actin, bate actin, β actin, Actin cytoplasmic 1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, A549 cells, C6 cells, HeLa cells, mouse colon tissue, Caco-2 cells, RAW 264.7 cells, SMMC-7721 cells, HepG2 cells, Jurkat cells, mouse brain tissue, rat brain tissue, NIH/3T3 cells, mouse liver tissue, rat kidney tissue, rat spleen tissue, rat liver tissue
Positive IHC detected inhuman colon tissue, human kidney tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inMDCK cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:4000-1:10000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

20536-1-AP targets Beta Actin in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat, canine, monkey samples.

Tested Reactivity human, mouse, rat, canine, monkey
Cited Reactivityhuman, mouse, rat, chicken, goat, sheep, yeast, ochotona curzoniae, camelus bactrianus, carp
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag14521

Product name: Recombinant human beta actin protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-50 aa of BC002409

Sequence: MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQK

Predict reactive species
Full Name actin, beta
Calculated Molecular Weight 375 aa, 42 kDa
Observed Molecular Weight 42 kDa
GenBank Accession NumberBC002409
Gene Symbol Beta Actin
Gene ID (NCBI) 60
RRIDAB_10700003
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP60709
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Beta Actin, also named as ACTB and F-Actin, belongs to the actin family. Actins are highly conserved globular proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells. At least six isoforms of actins are known in mammals and other vertebrates: alpha (ACTC1, cardiac muscle 1), alpha 1 (ACTA1, skeletal muscle) and 2 (ACTA2, aortic smooth muscle), beta (ACTB), gamma 1 (ACTG1) and 2 (ACTG2, enteric smooth muscle). Beta and gamma 1 are two non-muscle actin proteins. Most actins consist of 376aa, while ACTG2 (rich in muscles) has 375aa and ACTG1(found in non-muscle cells) has only 374aa. Beta actin has been widely used as the internal control in RT-PCR and Western Blotting as a 42-kDa protein. However, the 37-40, 31, 15 kDa cleaved fragment of beta actin can be generated during apoptosis process. This antibody was generated against N-terminal region of human beta actin protein and can cross-react with other actins. (9173887, 11217076, 10229193 )

Protocols

Product Specific Protocols
IF protocol for Beta Actin antibody 20536-1-APDownload protocol
IHC protocol for Beta Actin antibody 20536-1-APDownload protocol
WB protocol for Beta Actin antibody 20536-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

Nature

A plant-derived natural photosynthetic system for improving cell anabolism

Authors - Pengfei Chen

Nature

Promotion of DNA end resection by BRCA1-BARD1 in homologous recombination

Authors - Sameer Salunkhe
humanWB

Cancer Cell

Targeting the immune privilege of tumor-initiating cells to enhance cancer immunotherapy

Authors - Chen Yang
mouseWB

Nature

Aspm knockout ferret reveals an evolutionary mechanism governing cerebral cortical size.

Authors - Matthew B Johnson

Signal Transduct Target Ther

Identifying genetic targets in clinical subtypes of Parkinson's disease for optimizing pharmacological treatment strategies

Authors - Dewen Kong
WB

Cell

Microglia jointly degrade fibrillar alpha-synuclein cargo by distribution through tunneling nanotubes.

Authors - Hannah Scheiblich

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Mounika (Verified Customer) (03-24-2026)

Great Saviour for our research projects to validate all the cell lines!

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
FH

Sai Sindhura (Verified Customer) (01-08-2026)

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
FH

Shivam (Verified Customer) (01-02-2026)

prominent bands. Very few unspecific binding.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: MEF cells
FH

Matthieu (Verified Customer) (09-24-2025)

Produces a clear band in WB at the expected molecular weight

  • Applications: Western Blot
  • Primary Antibody Dilution: 1/1000
  • Cell Tissue Type: Human fibroblasts
FH

Manon (Verified Customer) (09-17-2025)

Very good housekeeping antibody

  • Applications: Western Blot
  • Primary Antibody Dilution: 1/1000
  • Cell Tissue Type: Fibroblasts
FH

YINGJIAN (Verified Customer) (05-27-2025)

This primary antibody is effective, even at a low concentration (1:10000).

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:10000
  • Cell Tissue Type: mouse liver
Beta Actin Antibody Western Blot validation (1:10000 dilution) in mouse liver (Cat no:20536-1-AP)
FH

Julia (Verified Customer) (06-20-2023)

Our lab has been using Proteintech's beta actin polyclonal antibody for years. We use this antibody in all our western blot experiments for normalization. This antibody works consistently at a 1:1000 dilution for human and mouse retina and for HRECs. We have always gotten a beautiful result, with nice thick and specific bands. The only downside is that this antibody is hard to strip. Even after stripping, the membrane tends to have residual beta actin bands. Even so, we would highly recommend this product for routine western blots.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: mouse retina, human retina, human retinal endothelial cell line
Beta Actin Antibody Western Blot validation (1:1000 dilution) in mouse retina, human retina, human retinal endothelial cell line (Cat no:20536-1-AP)
FH

Chun (Verified Customer) (06-19-2022)

This antibody worked very well.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1,000
  • Cell Tissue Type: HeLa cells and HEK293 cells
FH

Aaron (Verified Customer) (12-08-2020)

nice bands achieved

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:2000
  • Cell Tissue Type: Rat epidermal keratinocytes
FH

Wei (Verified Customer) (01-30-2020)

Strong, clear band for basal heart tissues.Good for internal control for heart diseases.

  • Applications: Western Blot,
  • Cell Tissue Type: Mouse Heart
FH

SCOTT (Verified Customer) (10-11-2019)

Used 1/1000 overnight 4 C. overnightHuman Grey matter cortex post mortem material

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1/1000
  • Cell Tissue Type: Human Grey matter cortex post mortem
Beta Actin Antibody Western Blot, validation (1/1000 dilution) in Human Grey matter cortex post mortem (Cat no:20536-1-AP)
FH

Dan (Verified Customer) (08-19-2019)

The antibody works

  • Applications: Western Blot, Immunohistochemistry,
FH

Kishor (Verified Customer) (01-30-2019)

Working well for Western Blotting (1:5000)

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:5000
  • Cell Tissue Type: H69, HUCCT-1 and Rat Liver tissue
Beta Actin Antibody Western Blot, validation (1:5000 dilution) in H69, HUCCT-1 and Rat Liver tissue (Cat no:20536-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...