• Featured Product
  • KD/KO Validated

CoraLite® Plus 647-conjugated Beta Actin Polyclonal antibody

Beta Actin Polyclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL647-20536

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, canine, monkey

Applications

IF/ICC, FC (Intra)

ACTB, Actin, bate actin, β actin, Actin cytoplasmic 1

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 647
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL647-20536 targets Beta Actin in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat, canine, monkey samples.

Tested Reactivity human, mouse, rat, canine, monkey
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag14521

Product name: Recombinant human beta actin protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-50 aa of BC002409

Sequence: MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQK

Predict reactive species
Full Name actin, beta
Calculated Molecular Weight 375 aa, 42 kDa
Observed Molecular Weight 42 kDa
GenBank Accession NumberBC002409
Gene Symbol Beta Actin
Gene ID (NCBI) 60
RRIDAB_2934941
Conjugate CoraLite® Plus 647 Fluorescent Dye
Excitation/Emission Maxima Wavelengths654 nm / 674 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP60709
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Beta Actin, also named as ACTB and F-Actin, belongs to the actin family. Actins are highly conserved globular proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells. At least six isoforms of actins are known in mammals and other vertebrates: alpha (ACTC1, cardiac muscle 1), alpha 1 (ACTA1, skeletal muscle) and 2 (ACTA2, aortic smooth muscle), beta (ACTB), gamma 1 (ACTG1) and 2 (ACTG2, enteric smooth muscle). Beta and gamma 1 are two non-muscle actin proteins. Most actins consist of 376aa, while ACTG2 (rich in muscles) has 375aa and ACTG1(found in non-muscle cells) has only 374aa. Beta actin has been widely used as the internal control in RT-PCR and Western Blotting as a 42-kDa protein. However, the 37-40, 31, 15 kDa cleaved fragment of beta actin can be generated during apoptosis process. This antibody was generated against N-terminal region of human beta actin protein and can cross-react with other actins. (9173887, 11217076, 10229193 )

Protocols

Product Specific Protocols
FC protocol for CL Plus 647 Beta Actin antibody CL647-20536Download protocol
IF protocol for CL Plus 647 Beta Actin antibody CL647-20536Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...