Tested Applications
| Positive WB detected in | mouse skeletal muscle tissue, rat skeletal muscle tissue |
| Positive IHC detected in | mouse skeletal muscle tissue, human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse skeletal muscle tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:16000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 3 publications below |
Product Information
24378-1-AP targets ACTN3 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag19479 Product name: Recombinant human ACTN3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 577-624 aa of BC099647 Sequence: RERGAIMGIQGEIQKICQTYGLRPCSTNPYITLSPQDINTKWDMVRKL Predict reactive species |
| Full Name | actinin, alpha 3 |
| Calculated Molecular Weight | 901 aa, 103 kDa |
| Observed Molecular Weight | 100 kDa |
| GenBank Accession Number | BC099647 |
| Gene Symbol | ACTN3 |
| Gene ID (NCBI) | 89 |
| RRID | AB_2879515 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q08043 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Alpha-actinin-3(ACTN3) is a member of the alpha-actin binding protein gene family. The members of this family are actin cross-linking proteins, among which ACTN2 and ACTN3 are muscle-specific subtypes. ACTN3 is primarily expressed in skeletal muscle and functions as a structural component of the sarcomeric Z line.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for ACTN3 antibody 24378-1-AP | Download protocol |
| IHC protocol for ACTN3 antibody 24378-1-AP | Download protocol |
| WB protocol for ACTN3 antibody 24378-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Dokl Biochem Biophys Early Deсline in Rat Soleus Passive Tension with Hindlimb Unloading: Inactivation of Cross-bridges or Activation of Calpains? | ||
Cell Metab Muscle-derived small extracellular vesicles induce liver fibrosis during overtraining | ||
FASEB J Overexpression of enhanced yellow fluorescent protein fused with Channelrhodopsin-2 causes contractile dysfunction in skeletal muscle |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Edma (Verified Customer) (03-03-2025) | The antibody worked very well in western blot :)
![]() |
FH Joleen (Verified Customer) (06-12-2019) | The antibody recognizes ACTN3 (top band) but also other non-specific proteins, though less prominently.
![]() |

















