Use Able AI chat for product recommendations

CoraLite® Plus 488-conjugated ACTN3 Polyclonal antibody

ACTN3 Polyclonal Antibody for IF-P, FC (Intra)

Cat No. CL488-24378

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF-P, FC (Intra)

actinin, alpha 3, ACTN 3, Alpha actinin 3, Alpha-actinin skeletal muscle isoform 3, Alpha-actinin-3

Formulation:  PBS, Proclin300, BSA, Glycerol
PBS, Proclin300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inmouse skeletal muscle tissue
Positive FC (Intra) detected inC2C12 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-24378 targets ACTN3 in IF-P, FC (Intra) applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag19479

Product name: Recombinant human ACTN3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 577-624 aa of BC099647

Sequence: RERGAIMGIQGEIQKICQTYGLRPCSTNPYITLSPQDINTKWDMVRKL

Predict reactive species
Full Name actinin, alpha 3
Calculated Molecular Weight 901 aa, 103 kDa
Observed Molecular Weight 100 kDa
GenBank Accession NumberBC099647
Gene Symbol ACTN3
Gene ID (NCBI) 89
RRIDAB_3672764
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ08043
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Alpha-actinin-3(ACTN3) is a member of the alpha-actin binding protein gene family. The members of this family are actin cross-linking proteins, among which ACTN2 and ACTN3 are muscle-specific subtypes. ACTN3 is primarily expressed in skeletal muscle and functions as a structural component of the sarcomeric Z line.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 ACTN3 antibody CL488-24378Download protocol
IF protocol for CL Plus 488 ACTN3 antibody CL488-24378Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...