Product Information
84356-1-PBS targets ACTN3 in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Recombinant |
Type | Antibody |
Immunogen |
CatNo: Ag36709 Product name: Recombinant human ACTN3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 577-624 aa of BC099647 Sequence: RERGAIMGIQGEIQKICQTYGLRPCSTNPYITLSPQDINTKWDMVRKL Predict reactive species |
Full Name | actinin, alpha 3 |
Calculated Molecular Weight | 901 aa, 103 kDa |
Observed Molecular Weight | 100 kDa |
GenBank Accession Number | BC099647 |
Gene Symbol | ACTN3 |
Gene ID (NCBI) | 89 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purfication |
UNIPROT ID | Q08043 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |