ACTN3 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• ACTN3 Recombinant monoclonal antibody (84356-1-RR)

ACTN3 Uni-rAb^® Recombinant Antibody for WB, IHC, IF-P, ELISA

Cat No. 84356-1-RR

Clone No.241168A5

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, ELISA

Synonyms

241168A5, actinin, alpha 3, ACTN 3, Alpha actinin 3, Alpha-actinin skeletal muscle isoform 3

• 

  WB analysis of rat skeletal muscle using 84356-1-RR

  rat skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 84356-1-RR (ACTN3 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse skeletal muscle using 84356-1-RR

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 84356-1-RR (ACTN3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of mouse skeletal muscle using 84356-1-RR

  Immunofluorescent analysis of (4% PFA) fixed mouse skeletal muscle tissue using ACTN3 antibody (84356-1-RR, Clone: 241168A5 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Affinity and Kinetic Characterization of 84356-1-RR

  Biolayer interferometry (BLl) kinetic assays of 84356-1-RR against Human ACTN3 were performed. The affinity constant is 0.116 nM.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: rat skeletal muscle tissue
• Positive IHC detected in: mouse skeletal muscle tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse skeletal muscle tissue

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

84356-1-RR targets ACTN3 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag36709

  Product name: Recombinant human ACTN3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 577-624 aa of BC099647

  Sequence: RERGAIMGIQGEIQKICQTYGLRPCSTNPYITLSPQDINTKWDMVRKL

• Full Name: actinin, alpha 3
• Calculated Molecular Weight: 901 aa, 103 kDa
• Observed Molecular Weight: 100 kDa
• GenBank Accession Number: BC099647
• Gene Symbol: ACTN3
• Gene ID (NCBI): 89
• RRID: AB_3671894
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q08043
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Alpha-actinin-3(ACTN3) is a member of the alpha-actin binding protein gene family. The members of this family are actin cross-linking proteins, among which ACTN2 and ACTN3 are muscle-specific subtypes. ACTN3 is primarily expressed in skeletal muscle and functions as a structural component of the sarcomeric Z line.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat	IF, WB	Biomolecules; Integrated Proteomic and Metabolomic Analysis of Muscle Atrophy Induced by Hindlimb Unloading.; Authors - Yuan Wang