Tested Applications
| Positive WB detected in | MCF-7 cells |
| Positive IHC detected in | human tonsillitis tissue, human lymphoma tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:200-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 4 publications below |
| IHC | See 5 publications below |
| IF | See 1 publications below |
Product Information
17899-1-AP targets ADAMDEC1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag12265 Product name: Recombinant human ADAMDEC1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 56-470 aa of BC074877 Sequence: REIKNNQTEKHGKEERYEPEVQYQMILNGEEIILSLQKTKHLLGPDYTETLYSPRGEEITTKPENMEHCYYKGNILNEKNSVASISTCDGLRGYFTHHHQRYQIKPLKSTDEKEHAVFTSNQEEQDPANHTCGVKSTDGKQGPIRISRSLKSPEKEDFLRAQKYIDLYLVLDNAFYKNYNENLTLIRSFVFDVMNLLNVIYNTIDVQVALVGMEIWSDGDKIKVVPSASTTFDNFLRWHSSNLGKKIHDHAQLLSGISFNNRRVGLAASNSLCSPSSVAVIEAKKKNNVALVGVMSHELGHVLGMPDVPFNTKCPSGSCVMNQYLSSKFPKDFSTSCRAHFERYLLSQKPKCLLQAPIPTNIMTTPVCGNHLLEVGEDCDCGSPKECTNLCCEALTCKLKPGTDCGGDAPNHTTE Predict reactive species |
| Full Name | ADAM-like, decysin 1 |
| Calculated Molecular Weight | 470 aa, 53 kDa |
| Observed Molecular Weight | 44 kDa |
| GenBank Accession Number | BC074877 |
| Gene Symbol | ADAMDEC1 |
| Gene ID (NCBI) | 27299 |
| RRID | AB_2878461 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O15204 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Metalloendopeptidase ADAM-Like Decysin 1 (ADAMDEC1) was first identified as a unique member of the matrix metalloprotease (ADAM) family. ADAMs are increasingly recognized as playing an important role in gut homeostasis and bowel inflammation. ADAMDEC1 is abundantly, and almost exclusively, expressed in the gastrointestinal (GI) tract.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for ADAMDEC1 antibody 17899-1-AP | Download protocol |
| IHC protocol for ADAMDEC1 antibody 17899-1-AP | Download protocol |
| WB protocol for ADAMDEC1 antibody 17899-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Arch Toxicol A transcriptome-wide association study integrating multi-omics bioinformatics and Mendelian randomization reveals the prognostic value of ADAMDEC1 in colon cancer | ||
J Inflamm Res The m6A/m1A/m5C-Related Methylation Modification Patterns and Immune Landscapes in Rheumatoid Arthritis and Osteoarthritis Revealed by Microarray and Single-Cell Transcriptome | ||
Thorac Cancer Upregulation of ADAMDEC1 correlates with tumor progression and predicts poor prognosis in non-small cell lung cancer (NSCLC) via the PI3K/AKT pathway. | ||
Aging (Albany NY) An immune signature to predict the prognosis of ATRX-wildtype glioma patients and guide immune checkpoint blockade therapy | ||
Sci Rep ADAMDEC1 promotes the malignant progression of cholangiocarcinoma by regulating NF-κB signaling pathway | ||
Exp Cell Res ADAMDEC1 induces EMT and promotes colorectal cancer cells metastasis by enhancing Wnt/β-catenin signaling via negative modulation of GSK3β
|











