Tested Applications
Positive WB detected in | mouse brain tissue |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:200-1:1000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 1 publications below |
IF | See 1 publications below |
Product Information
21071-1-AP targets ADORA2B in WB, IF, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Cited Reactivity | mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag15214 Product name: Recombinant human ADORA2B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 278-332 aa of BC025722 Sequence: LSHANSVVNPIVYAYRNRDFRYTFHKIISRYLLCQADVKSGNGQAGVQPALGVGL Predict reactive species |
Full Name | adenosine A2b receptor |
Calculated Molecular Weight | 332 aa, 36 kDa |
Observed Molecular Weight | 36 kDa |
GenBank Accession Number | BC025722 |
Gene Symbol | ADORA2B |
Gene ID (NCBI) | 136 |
RRID | AB_2918069 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P29275 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for ADORA2B antibody 21071-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |