ADRA1B Polyclonal antibody, PBS Only

• 

  WB analysis using 22419-1-AP (same clone as 22419-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 22419-1-AP (ADRA1B antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 22419-1-PBS in a different storage buffer formulation.

• 

  FC experiment of PC-3 using 22419-1-AP (same clone as 22419-1-PBS)

  1x10^6 PC-3 cells were intracellularly stained with 0.8 ug ADRA1B Polyclonal antibody (22419-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.8 ug Rabbit IgG control Rabbit PolyAb (30000-0-AP) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C). This data was developed using the same antibody clone with 22419-1-PBS in a different storage buffer formulation.

ADRA1B Polyclonal Antibody for WB, Indirect ELISA

Cat No. 22419-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

22419-1-PBS targets ADRA1B in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18138

  Product name: Recombinant human ADRA1B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 381-520 aa of BC136569

  Sequence: LGGCAYTYRPWTRGGSLERSQSRKDSLDDSGSCLSGSQRTLPSASPSPGYLGRGAPPPVELCAFPEWKAPGALLSLPAPEPPGRRGRHDSGPLFTFKLLTEPESPGTDGGASNGGCEAAADVANGQPGFKSNMPLAPGQF

• Full Name: adrenergic, alpha-1B-, receptor
• Calculated Molecular Weight: 520 aa, 57 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC136569
• Gene Symbol: ADRA1B
• Gene ID (NCBI): 147
• RRID: AB_2879103
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: P35368
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.