Product Information
83349-1-PBS targets AGPAT2 as part of a matched antibody pair:
MP00360-2: 83349-3-PBS capture and 83349-1-PBS detection (validated in Cytometric bead array)
MP00360-3: 83349-4-PBS capture and 83349-1-PBS detection (validated in Cytometric bead array)
Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Recombinant |
Type | Antibody |
Immunogen |
CatNo: Ag34761 Product name: Recombinant human AGPAT2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 201-279 aa of BC019292 Sequence: VPVVYSSFSSFYNTKKKFFTSGTVTVQVLEAIPTSGLTAADVPALVDTCHRAMRTTFLHISKTPQENGATAGSGVQPAQ Predict reactive species |
Full Name | 1-acylglycerol-3-phosphate O-acyltransferase 2 (lysophosphatidic acid acyltransferase, beta) |
Calculated Molecular Weight | 31 kDa |
GenBank Accession Number | BC019292 |
Gene Symbol | AGPAT2 |
Gene ID (NCBI) | 10555 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | O15120 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |