AGPAT2 Recombinant monoclonal antibody, PBS Only (Capture)

AGPAT2 Uni-rAb® Recombinant Antibody for WB, IHC, FC (Intra), Cytometric bead array, Sandwich ELISA, Indirect ELISA
Cat No. 83349-3-PBS
Clone No.240153C2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, FC (Intra), Cytometric bead array, Sandwich ELISA, Indirect ELISA

1 AGPAT2, 1-acylglycerol-3-phosphate O-acyltransferase 2, 1-acyl-sn-glycerol-3-phosphate acyltransferase beta, 1-AGP acyltransferase 2, 1-AGPAT 2

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83349-3-PBS targets AGPAT2 as part of a matched antibody pair:

MP00360-2: 83349-3-PBS capture and 83349-1-PBS detection (validated in Cytometric bead array)

MP00360-4: 83349-3-PBS capture and 83349-4-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag34761

Product name: Recombinant human AGPAT2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 201-279 aa of BC019292

Sequence: VPVVYSSFSSFYNTKKKFFTSGTVTVQVLEAIPTSGLTAADVPALVDTCHRAMRTTFLHISKTPQENGATAGSGVQPAQ

Predict reactive species
Full Name 1-acylglycerol-3-phosphate O-acyltransferase 2 (lysophosphatidic acid acyltransferase, beta)
Calculated Molecular Weight 31 kDa
Observed Molecular Weight27 kDa
GenBank Accession NumberBC019292
Gene Symbol AGPAT2
Gene ID (NCBI) 10555
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO15120
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

1-acyl-sn-glycerol-3-phosphate acyltransferase beta (AGPAT2) belongs to a family of enzymes catalyzing the sn-2 acylation of the glycerol-3-phosphate backbone. AGPAT2 is highly expressed in adipose tissues, liver, and skeletal muscle. AGPAT2 is the only AGPAT isoform whose loss-of-function mutations cause a severe form of human congenital generalized lipodystrophy (PMID: 34824276). Human and mouse AGPAT2 have a calculated molecular mass of 31 kDa, and an alternatively spliced form of AGPAT2 mRNA, encoding a protein of 246 rather than 278 amino acids, is also found in human (PMID: 19336658). Western detected AGPAT2 at an apparent molecular mass of 27 kDa.

Loading...
||
New chat Able
正在加载,请稍候...