GPAT3 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• GPAT3 Polyclonal antibody (20603-1-AP)

• Featured Product
• KD/KO Validated

GPAT3 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA

Cat No. 20603-1-AP

Publications(18)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), ELISA

Synonyms

AGPAT9, 1 AGP acyltransferase 9, 1 AGPAT 9, 1-acyl-sn-glycerol-3-phosphate O-acyltransferase 10, 1-acyl-sn-glycerol-3-phosphate O-acyltransferase 9

• 

  WB analysis of rat kidney using 20603-1-AP

  rat kidney tissue were subjected to SDS PAGE followed by western blot with 20603-1-AP (AGPAT9 Antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 20603-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 20603-1-AP (AGPAT9 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HT-1080 using 20603-1-AP

  HT-1080 cells were subjected to SDS PAGE followed by western blot with 20603-1-AP (AGPAT9 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 20603-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 20603-1-AP (AGPAT9 Antibody) at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 20603-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 20603-1-AP (AGPAT9 Antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 20603-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 20603-1-AP (AGPAT9 Antibody) at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 20603-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 20603-1-AP (AGPAT9 Antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 20603-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 20603-1-AP (AGPAT9 antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 20603-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 20603-1-AP (AGPAT9 antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 20603-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using AGPAT9 antibody (20603-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of HepG2 using 20603-1-AP

  1X10^6 HepG2 cells were intracellularly stained with 0.4 ug Anti-Human AGPAT9 (20603-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Isotype Control. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: rat kidney tissue, HeLa cells, HT-1080 cells
• Positive IHC detected in: human kidney tissue, human liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells
• Positive FC (Intra) detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunohistochemistry (IHC): IHC : 1:50-1:400
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

20603-1-AP targets GPAT3 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14579

  Product name: Recombinant human AGPAT9 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-81 aa of BC006236

  Sequence: LRMMTSWAIVCDVWYMPPMTREEGEDAVQFANRVKSAIAIQGGLTELPWDGGLKRAKVKDIFKEEQQKNYSKMIVGNGSLS

• Full Name: 1-acylglycerol-3-phosphate O-acyltransferase 9
• Calculated Molecular Weight: 49 kDa
• Observed Molecular Weight: 49 kDa
• GenBank Accession Number: BC006236
• Gene Symbol: AGPAT9
• Gene ID (NCBI): 84803
• RRID: AB_10694289
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q53EU6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GPAT3, also known as AGPAT9, is a member of the lysophosphatidic acid acyltransferase protein family. GPAT3 is an enzyme that catalyzes the conversion of glycerol-3-phosphate to lysophosphatidic acid in the synthesis of triacylglycerol.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Nat Cell Biol; AIDA directly connects sympathetic innervation to adaptive thermogenesis by UCP1.; Authors - Meng Shi
mouse	WB	Cell Metab; AIDA Selectively Mediates Downregulation of Fat Synthesis Enzymes by ERAD to Retard Intestinal Fat Absorption and Prevent Obesity.; Authors - Hui Luo
		Phytomedicine; Astragaloside IV alleviates radiation-induced heart disease by regulating energy metabolism; Authors - Qiyang Li
mouse	WB	Hum Mol Genet; PMID: 31873720; Authors - Mingming Gao ; KO Validated
rat	WB	Metabolites; Integrated Metabolomics and Lipidomics Analysis Reveals the Mechanism Behind the Action of Chiglitazar on the Protection Against Sepsis-Induced Acute Lung Injury; Authors - Liu-Liu Lu
		J Anim Sci Biotechnol; Se-enriched yeast improves meat quality through glycerophospholipid metabolism in finishing pigs: insights from a multi-omics analysis.; Authors - Xiangqi Qiu