Tested Applications
| Positive WB detected in | rat kidney tissue, HeLa cells, HT-1080 cells |
| Positive IHC detected in | human kidney tissue, human liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
| Positive FC (Intra) detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:400 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below |
| WB | See 12 publications below |
| IF | See 1 publications below |
Product Information
20603-1-AP targets GPAT3 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag14579 Product name: Recombinant human AGPAT9 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-81 aa of BC006236 Sequence: LRMMTSWAIVCDVWYMPPMTREEGEDAVQFANRVKSAIAIQGGLTELPWDGGLKRAKVKDIFKEEQQKNYSKMIVGNGSLS Predict reactive species |
| Full Name | 1-acylglycerol-3-phosphate O-acyltransferase 9 |
| Calculated Molecular Weight | 49 kDa |
| Observed Molecular Weight | 49 kDa |
| GenBank Accession Number | BC006236 |
| Gene Symbol | AGPAT9 |
| Gene ID (NCBI) | 84803 |
| RRID | AB_10694289 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q53EU6 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
GPAT3, also known as AGPAT9, is a member of the lysophosphatidic acid acyltransferase protein family. GPAT3 is an enzyme that catalyzes the conversion of glycerol-3-phosphate to lysophosphatidic acid in the synthesis of triacylglycerol.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for GPAT3 antibody 20603-1-AP | Download protocol |
| IF protocol for GPAT3 antibody 20603-1-AP | Download protocol |
| IHC protocol for GPAT3 antibody 20603-1-AP | Download protocol |
| WB protocol for GPAT3 antibody 20603-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nat Cell Biol AIDA directly connects sympathetic innervation to adaptive thermogenesis by UCP1. | ||
Cell Metab AIDA Selectively Mediates Downregulation of Fat Synthesis Enzymes by ERAD to Retard Intestinal Fat Absorption and Prevent Obesity. | ||
Phytomedicine Astragaloside IV alleviates radiation-induced heart disease by regulating energy metabolism | ||
Biomed Pharmacother Si-Ni-San reverses dietary fat absorption defects in a murine model of depression | ||
Metabolites Integrated Metabolomics and Lipidomics Analysis Reveals the Mechanism Behind the Action of Chiglitazar on the Protection Against Sepsis-Induced Acute Lung Injury |





















