Tested Applications
| Positive WB detected in | A549 cells, rat colon tissue, rat stomach tissue, mouse stomach tissue |
| Positive IP detected in | A549 cells |
| Positive IHC detected in | human breast cancer tissue, human colon tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | A549 cells |
| Positive FC (Intra) detected in | A549 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
12275-1-AP targets AGR2 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2919 Product name: Recombinant human AGR2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 17-175 aa of BC015503 Sequence: YTLARDTTVKPGAKKDTKDSRPKLPQTLSRGWGDQLIWTQTYEEALYKSKTSNKPLMIIHHLDECPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSLTVRADITGRYSNRLYAYEPADTALLLDNMKKALKLLKTEL Predict reactive species |
| Full Name | anterior gradient homolog 2 (Xenopus laevis) |
| Calculated Molecular Weight | 175 aa, 20 kDa |
| Observed Molecular Weight | 17-20 kDa |
| GenBank Accession Number | BC015503 |
| Gene Symbol | AGR2 |
| Gene ID (NCBI) | 10551 |
| RRID | AB_2225096 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O95994 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
AGR2, also named AG2 or HPC8, encodes anterior gradient protein 2 homolog which belongs to the AGR family. It is a secreted protein localized in endoplasmic reticulum. AGR2 plays roles in MUC2 post-transcriptional synthesis,secretion and production of mucus by intestinal cells. AGR2 was significantly elevated in the pancreatic juice from patients with pre-malignant conditions as well as pancreatic cancer compared to control pancreatic juice samples. AGR2 levels in pancreatic juice could potentially be used in assessment of high-risk patients undergoing endoscopic procedures.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for AGR2 antibody 12275-1-AP | Download protocol |
| IF protocol for AGR2 antibody 12275-1-AP | Download protocol |
| IHC protocol for AGR2 antibody 12275-1-AP | Download protocol |
| IP protocol for AGR2 antibody 12275-1-AP | Download protocol |
| WB protocol for AGR2 antibody 12275-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The AGR2 (Anterior Gradient 2) antibody (Cat# 12275-1-AP) has 25 total citations spanning journals including Cell, Immunity, Nature Cell Biology, Nature Communications, PNAS, Developmental Cell, Cancer Letters, and EMBO Molecular Medicine. Research fields covered include oncology (prostate, cervical, colorectal, breast, lung, and pancreatic cancers), immunology, ER proteostasis, inflammation, spatial proteomics, diabetes, and intestinal barrier biology. Applications include WB, IHC, IF, and IP across human, mouse, and rat species.
| Species | Application | Title |
|---|---|---|
Signal Transduct Target Ther Integrative multi-omics and drug-response characterization of patient-derived prostate cancer primary cells | ||
Cell High-resolution spatially resolved proteomics of complex tissues based on microfluidics and transfer learning | ||
Immunity Unfolded protein response transcription factor XBP1 suppresses necroptosis-induced colitis by reinforcing the mucus barrier | ||
Nat Cell Biol Opposing Wnt signals regulate cervical squamocolumnar homeostasis and emergence of metaplasia. | ||
Nat Protoc Patient-derived and mouse endo-ectocervical organoid generation, genetic manipulation and applications to model infection. | ||
Nat Commun Single-cell division tracing and transcriptomics reveal cell types and differentiation paths in the regenerating lung |
Reviews
What customers say
The single review for 12275-1-AP was posted on October 17, 2025 by a researcher using mouse tissue for Western Blot. They used a 1:1000 dilution (Lot 00058183) and gave the product a 5-star rating, commenting "GREAT FOR WB." Overall, the feedback is positive, indicating strong performance in Western Blot applications at a standard dilution.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
MALLIKARJUNA (Verified Customer) (10-17-2025) | GREAT FOR wb
|
