Tested Applications
Positive WB detected in | A549 cells, rat colon tissue, rat stomach tissue, mouse stomach tissue |
Positive IP detected in | A549 cells |
Positive IHC detected in | human breast cancer tissue, human colon tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | A549 cells |
Positive FC (Intra) detected in | A549 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 2 publications below |
WB | See 9 publications below |
IHC | See 9 publications below |
IF | See 7 publications below |
IP | See 1 publications below |
Product Information
12275-1-AP targets AGR2 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag2919 Product name: Recombinant human AGR2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 17-175 aa of BC015503 Sequence: YTLARDTTVKPGAKKDTKDSRPKLPQTLSRGWGDQLIWTQTYEEALYKSKTSNKPLMIIHHLDECPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSLTVRADITGRYSNRLYAYEPADTALLLDNMKKALKLLKTEL Predict reactive species |
Full Name | anterior gradient homolog 2 (Xenopus laevis) |
Calculated Molecular Weight | 175 aa, 20 kDa |
Observed Molecular Weight | 17-20 kDa |
GenBank Accession Number | BC015503 |
Gene Symbol | AGR2 |
Gene ID (NCBI) | 10551 |
RRID | AB_2225096 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | O95994 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
AGR2, also named AG2 or HPC8, encodes anterior gradient protein 2 homolog which belongs to the AGR family. It is a secreted protein localized in endoplasmic reticulum. AGR2 plays roles in MUC2 post-transcriptional synthesis,secretion and production of mucus by intestinal cells. AGR2 was significantly elevated in the pancreatic juice from patients with pre-malignant conditions as well as pancreatic cancer compared to control pancreatic juice samples. AGR2 levels in pancreatic juice could potentially be used in assessment of high-risk patients undergoing endoscopic procedures.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for AGR2 antibody 12275-1-AP | Download protocol |
IHC protocol for AGR2 antibody 12275-1-AP | Download protocol |
IF protocol for AGR2 antibody 12275-1-AP | Download protocol |
IP protocol for AGR2 antibody 12275-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Nat Cell Biol Opposing Wnt signals regulate cervical squamocolumnar homeostasis and emergence of metaplasia. | ||
Nat Protoc Patient-derived and mouse endo-ectocervical organoid generation, genetic manipulation and applications to model infection. | ||
Cell Rep Med Distinctive multicellular immunosuppressive hubs confer different intervention strategies for left- and right-sided colon cancers | ||
Proc Natl Acad Sci U S A A discrete population of squamocolumnar junction cells implicated in the pathogenesis of cervical cancer. | ||
J Pathol A novel blueprint for 'top down' differentiation defines the cervical squamocolumnar junction during development, reproductive life, and neoplasia. | ||
Int J Cancer Unique recurrence patterns of cervical intraepithelial neoplasia following excision of the squamo-columnar junction. |