Tested Applications
| Positive WB detected in | pig heart tissue, pig skeletal muscle tissue, rat heart tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
66415-1-Ig targets AGTR1 in WB, ELISA applications and shows reactivity with human, mouse, rat, pig samples.
| Tested Reactivity | human, mouse, rat, pig |
| Cited Reactivity | human, mouse |
| Host / Isotype | Mouse / IgG2a |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag14461 Product name: Recombinant human AGTR1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 290-359 aa of BC022447 Sequence: IAYFNNCLNPLFYGFLGKKFKRYFLQLLKYIPPKAKSHSNLSTKMSTLSYRHSDNVSSSTKKPAPCFEVE Predict reactive species |
| Full Name | angiotensin II receptor, type 1 |
| Calculated Molecular Weight | 359 aa, 41 kDa |
| Observed Molecular Weight | 50 kDa |
| GenBank Accession Number | BC022447 |
| Gene Symbol | AGTR1 |
| Gene ID (NCBI) | 185 |
| RRID | AB_2881787 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P30556 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Angiotensin II (Ang II), the main effector molecule of the renin-angiotensin system, exerts its actions mainly via interaction with type-1 angiotensin II receptor (AGTR1, also named as AT1R), thereby contributing to blood pressure regulation. AGTR1 mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. By regulating vascular tone, cardiovascular function, salt and water homeostasis, AGTR1 exerts an indispensable physiological role (PMID: 21600887). AGTR1 has been implicated in diverse aspects of human disease, from the regulation of blood pressure and cardiovascular homeostasis to cancer progression (PMID: 26975580).
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for AGTR1 antibody 66415-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The AGTR1 Monoclonal antibody (2C5G11), catalog number 66415-1-Ig, has 2 citations. These appear in Journal of Advanced Research and International Journal of Biological Macromolecules. The cited research spans cardiovascular biology and vascular remodeling (Ang II-induced vascular modeling in zebrafish) and peripheral energy homeostasis regulation via the central renin-angiotensin system. Both studies utilized the antibody for Western blot analysis in mouse and human samples.
| Species | Application | Title |
|---|---|---|
J Adv Res Vitamin D/VDR regulates peripheral energy homeostasis via central renin-angiotensin system. | ||
Int J Biol Macromol A novel angiotensin I-converting enzyme inhibitory peptide APPLRP from Grifola frondosa ameliorated the Ang II-induced vascular modeling in zebrafish model by mediating smooth muscle cells |
Reviews
What customers say
One reviewer (rated 4/5) used this antibody at 1:1000 dilution on human placenta tissue by Western Blot. They were able to detect AT1R, but only with chemiluminescence detection. They noted that the positive control they used did not work, which was a limitation in their experiment.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Anca (Verified Customer) (10-30-2019) | We could detect AT1R from Plazenta, but only by using Chemiluminiscence. Unfortunately, the pozitive control that we used didn't worked.
|
