Tested Applications
Positive WB detected in | Jurkat cells, HeLa cells, NIH/3T3 cells, HEK-293 cells, HepG2 cells |
Positive IHC detected in | human kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:5000-1:50000 |
Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 1 publications below |
WB | See 1 publications below |
IHC | See 1 publications below |
CoIP | See 1 publications below |
Product Information
66602-1-Ig targets AGXT2 in WB, IHC, CoIP, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Cited Reactivity | human, mouse |
Host / Isotype | Mouse / IgG1 |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag26888 Product name: Recombinant human AGXT2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 201-300 aa of NM_001306173 Sequence: MSPYTLGLTNVGTYKMELPGGTGCQPTMCPDVFRGPWGGSHCRDSPVQTIRKCSCAPDCCQAKDQYIEQFKDTLSTSVAKSIAGFFAEPIQGVNGVVQYPK Predict reactive species |
Full Name | alanine-glyoxylate aminotransferase 2 |
Calculated Molecular Weight | 57 kDa |
Observed Molecular Weight | 57 kDa |
GenBank Accession Number | NM_001306173 |
Gene Symbol | AGXT2 |
Gene ID (NCBI) | 64902 |
RRID | AB_2881962 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein G purification |
UNIPROT ID | Q9BYV1 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for AGXT2 antibody 66602-1-Ig | Download protocol |
IHC protocol for AGXT2 antibody 66602-1-Ig | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |