AGXT2 Monoclonal antibody

• Home
• Products
• Primary Antibodies
• AGXT2 Monoclonal antibody (66602-1-Ig)

AGXT2 Monoclonal Antibody for WB, IHC, ELISA

Cat No. 66602-1-Ig Copied!

Clone No. 3A5B12

Publications (1)

Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

WB, IHC, CoIP, ELISA

Synonyms

3A5B12, AGT 2, AGT2, Beta ALAAT II, D AIBAT

• 

  WB analysis of HeLa using 66602-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 66602-1-Ig (AGXT2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 66602-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 66602-1-Ig (AGXT2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Jurkat using 66602-1-Ig

  Jurkat cells were subjected to SDS PAGE followed by western blot with 66602-1-Ig (AGXT2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 66602-1-Ig

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 66602-1-Ig (AGXT2 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 66602-1-Ig

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 66602-1-Ig (AGXT2 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for AGXT2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: Jurkat cells, HeLa cells, NIH/3T3 cells, HEK-293 cells, HepG2 cells
• Positive IHC detected in: human kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

66602-1-Ig targets AGXT2 in WB, IHC, CoIP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26888

  Product name: Recombinant human AGXT2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 201-300 aa of NM_001306173

  Sequence: MSPYTLGLTNVGTYKMELPGGTGCQPTMCPDVFRGPWGGSHCRDSPVQTIRKCSCAPDCCQAKDQYIEQFKDTLSTSVAKSIAGFFAEPIQGVNGVVQYPK

• Full Name: alanine-glyoxylate aminotransferase 2
• Calculated Molecular Weight: 57 kDa
• Observed Molecular Weight: 57 kDa
• GenBank Accession Number: NM_001306173
• Gene Symbol: AGXT2
• Gene ID (NCBI): 64902
• RRID: AB_2881962
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9BYV1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The AGXT2 Monoclonal antibody (3A5B12), catalog number 66602-1-Ig, has 1 total citation. It appears in the Journal of Hepatocellular Carcinoma (2024, IF 3.9). The cited study investigated AGXT2's role in suppressing proliferation and dissemination of hepatocellular carcinoma cells by modulating intracellular lipid metabolism, using WB, IHC, and CoIP applications in human and mouse samples. The research field is liver cancer and lipid metabolism.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse,human	WB,IHC,CoIP	J Hepatocell Carcinoma; AGXT2 Suppresses the Proliferation and Dissemination of Hepatocellular Carcinoma Cells by Modulating Intracellular Lipid Metabolism; Authors - Tian Chen ; KD Validated