AGXT2 Monoclonal antibody, PBS Only

• 

  WB analysis of HeLa using 66602-1-Ig (same clone as 66602-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66602-1-Ig (AGXT2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66602-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 66602-1-Ig (same clone as 66602-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66602-1-Ig (AGXT2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66602-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 66602-1-Ig (same clone as 66602-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 66602-1-Ig (AGXT2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66602-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 66602-1-Ig (same clone as 66602-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 66602-1-Ig (AGXT2 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66602-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 66602-1-Ig (same clone as 66602-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 66602-1-Ig (AGXT2 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66602-1-PBS in a different storage buffer formulation.

AGXT2 Monoclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 66602-1-PBS

Clone No.3A5B12

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

3A5B12, AGT 2, AGT2, Beta ALAAT II, D AIBAT

---

Product Information

66602-1-PBS targets AGXT2 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26888

  Product name: Recombinant human AGXT2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 201-300 aa of NM_001306173

  Sequence: MSPYTLGLTNVGTYKMELPGGTGCQPTMCPDVFRGPWGGSHCRDSPVQTIRKCSCAPDCCQAKDQYIEQFKDTLSTSVAKSIAGFFAEPIQGVNGVVQYPK

• Full Name: alanine-glyoxylate aminotransferase 2
• Calculated Molecular Weight: 57 kDa
• Observed Molecular Weight: 57 kDa
• GenBank Accession Number: NM_001306173
• Gene Symbol: AGXT2
• Gene ID (NCBI): 64902
• RRID: AB_2881962
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9BYV1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.