Product Information
66602-1-PBS targets AGXT2 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Host / Isotype | Mouse / IgG1 |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag26888 Product name: Recombinant human AGXT2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 201-300 aa of NM_001306173 Sequence: MSPYTLGLTNVGTYKMELPGGTGCQPTMCPDVFRGPWGGSHCRDSPVQTIRKCSCAPDCCQAKDQYIEQFKDTLSTSVAKSIAGFFAEPIQGVNGVVQYPK Predict reactive species |
Full Name | alanine-glyoxylate aminotransferase 2 |
Calculated Molecular Weight | 57 kDa |
Observed Molecular Weight | 57 kDa |
GenBank Accession Number | NM_001306173 |
Gene Symbol | AGXT2 |
Gene ID (NCBI) | 64902 |
RRID | AB_2881962 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | Q9BYV1 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |