AHCYL2 Monoclonal antibody, PBS Only

• 

  WB analysis of A549 using 67484-1-Ig (same clone as 67484-1-PBS)

  A549 cells were subjected to SDS PAGE followed by western blot with 67484-1-Ig (AHCYL2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67484-1-PBS in a different storage buffer formulation.

• 

  WB analysis of LNCaP using 67484-1-Ig (same clone as 67484-1-PBS)

  LNCaP cells were subjected to SDS PAGE followed by western blot with 67484-1-Ig (AHCYL2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67484-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 67484-1-Ig (same clone as 67484-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 67484-1-Ig (AHCYL2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67484-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach using 67484-1-Ig (same clone as 67484-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 67484-1-Ig (AHCYL2 antibody) at dilution of 1:600 (under 10x lens).. This data was developed using the same antibody clone with 67484-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach using 67484-1-Ig (same clone as 67484-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 67484-1-Ig (AHCYL2 antibody) at dilution of 1:600 (under 40x lens).. This data was developed using the same antibody clone with 67484-1-PBS in a different storage buffer formulation.

AHCYL2 Monoclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 67484-1-PBS

Clone No.1D1F6

Host / Isotype

Mouse / IgG2a

Reactivity

Human

Applications

WB, IHC, Indirect ELISA

Synonyms

AdoHcyase 3, AHCYL2, FLJ21719, KIAA0828

---

Product Information

67484-1-PBS targets AHCYL2 in WB, IHC, Indirect ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19614

  Product name: Recombinant human AHCYL2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-115 aa of BC024325

  Sequence: MSVQVVSAAAAAKVPEVELKDLSPSEAESQLGLSTAAVGAMAPPAGGGDPEAPAPAAERPPVPGPGSGPAAALSPAAGKVPQASAMKRSDPHHQHQRHRDGGEALVSPDGTVTEA

• Full Name: S-adenosylhomocysteine hydrolase-like 2
• Calculated Molecular Weight: 611 aa, 67 kDa
• Observed Molecular Weight: 67 and 57 kDa
• GenBank Accession Number: BC024325
• Gene Symbol: AHCYL2
• Gene ID (NCBI): 23382
• RRID: AB_2882711
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q96HN2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.