Tested Applications
| Positive WB detected in | A549 cells, LNCaP cells, HeLa cells |
| Positive IHC detected in | human stomach tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunohistochemistry (IHC) | IHC : 1:300-1:1200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
67484-1-Ig targets AHCYL2 in WB, IHC, ELISA applications and shows reactivity with Human samples.
| Tested Reactivity | Human |
| Host / Isotype | Mouse / IgG2a |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag19614 Product name: Recombinant human AHCYL2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-115 aa of BC024325 Sequence: MSVQVVSAAAAAKVPEVELKDLSPSEAESQLGLSTAAVGAMAPPAGGGDPEAPAPAAERPPVPGPGSGPAAALSPAAGKVPQASAMKRSDPHHQHQRHRDGGEALVSPDGTVTEA Predict reactive species |
| Full Name | S-adenosylhomocysteine hydrolase-like 2 |
| Calculated Molecular Weight | 611 aa, 67 kDa |
| Observed Molecular Weight | 67 and 57 kDa |
| GenBank Accession Number | BC024325 |
| Gene Symbol | AHCYL2 |
| Gene ID (NCBI) | 23382 |
| RRID | AB_2882711 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q96HN2 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for AHCYL2 antibody 67484-1-Ig | Download protocol |
| WB protocol for AHCYL2 antibody 67484-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |









