AK1 Polyclonal antibody, PBS Only

• 

  WB analysis using 14978-1-AP (same clone as 14978-1-PBS)

  mouse heart lysates were subjected to SDS PAGE followed by western blot with 14978-1-AP (AK1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14978-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 14978-1-AP (same clone as 14978-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 14978-1-AP (AK1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14978-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse skeletal muscle using 14978-1-AP (same clone as 14978-1-PBS)

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 14978-1-AP (AK1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14978-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human heart using 14978-1-AP (same clone as 14978-1-PBS)

  human heart tissue were subjected to SDS PAGE followed by western blot with 14978-1-AP (AK1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14978-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human heart using 14978-1-AP (same clone as 14978-1-PBS)

  human heart tissue were subjected to SDS PAGE followed by western blot with 14978-1-AP (AK1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14978-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse heart using 14978-1-AP (same clone as 14978-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 14978-1-AP (AK1 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14978-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse heart using 14978-1-AP (same clone as 14978-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 14978-1-AP (AK1 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14978-1-PBS in a different storage buffer formulation.

AK1 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 14978-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

adenylate kinase 1, Adenylate kinase isoenzyme 1, Adenylate monophosphate kinase, AK 1, ATP:AMP phosphotransferase

---

Product Information

14978-1-PBS targets AK1 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6890

  Product name: Recombinant human AK1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-194 aa of BC001116

  Sequence: MEEKLKKTNIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRSEVSSGSARGKKLSEIMEKGQLVPLETVLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEEFERRIGQPTLLLYVDAGPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFSQVCTHLDALK

• Full Name: adenylate kinase 1
• Calculated Molecular Weight: 22 kDa
• Observed Molecular Weight: 22 kDa
• GenBank Accession Number: BC001116
• Gene Symbol: AK1
• Gene ID (NCBI): 203
• RRID: AB_2225148
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P00568
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

AK1(Adenylate kinase isoenzyme 1), also known as ATP-AMP transphosphorylase 1. It is located in cytoplasm. This protein is highly expressed in skeletal muscle, brain and erythrocytes. Certain mutations in this gene resulting in a functionally inadequate enzyme are associated with a rare genetic disorder causing nonspherocytic hemolytic anemia. Catalyzes the reversible transfer of the terminal phosphate group between ATP and AMP 1. Exhibits nucleoside diphosphate kinase activity, catalyzing the production of ATP, CTP, GTP, UTP, dATP, dCTP, dGTP and dTTP from the corresponding diphosphate substrates with either ATP or GTP as phosphate donor 2. Also catalyzes at a very low rate the synthesis of thiamine triphosphate (ThTP) from thiamine diphosphate (ThDP) and ADP. The molecular weight of AK1 is 22 kDa.