Tested Applications
Positive WB detected in | K-562 cells, NIH/3T3 cells, mouse brain tissue, mouse heart tissue |
Positive IF/ICC detected in | HEK-293 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:3000 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
30539-1-AP targets ALAS2 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag30308 Product name: Recombinant human ALAS2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 502-574 aa of BC030230 Sequence: LLRLAPSPHHSPQMMEDFVEKLLLAWTAVGLPLQDVSVAACNFCRRPVHFELMSEWERSYFGNMGPQYVTTYA Predict reactive species |
Full Name | aminolevulinate, delta-, synthase 2 |
Calculated Molecular Weight | 587 aa, 65 kDa |
Observed Molecular Weight | 65 kDa |
GenBank Accession Number | BC030230 |
Gene Symbol | ALAS2 |
Gene ID (NCBI) | 212 |
RRID | AB_3086355 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P22557 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The heme biosynthetic pathway begins from delta aminolevulinic acid synthase (ALAS) catalyzing the condensation of glycine and succinyl-CoA to delta aminolevulinic acid (ALA) in the mitochondria. ALAS is coded by two genes: ALAS1 and ALAS2 . ALAS1 is ubiquitously expressed in all cells, and the negative feedback is regulated by the heme pool; however, ALAS2 is specifically expressed only in erythroid cells.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for ALAS2 antibody 30539-1-AP | Download protocol |
IF protocol for ALAS2 antibody 30539-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |