ALAS2 Polyclonal antibody

ALAS2 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 30539-1-AP

Publications (1)

Review Product

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, ELISA

Synonyms

5-aminolevulinate synthase, erythroid-specific, mitochondrial, 5-aminolevulinic acid synthase 2, ALAS 2, ALAS E, ALASE

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIF/ICC

WB analysis using 30539-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 30539-1-AP (ALAS2 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis using 30539-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 30539-1-AP (ALAS2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of HEK-293 using 30539-1-AP
Immunofluorescent analysis of (-20°C Ethanol) fixed HEK-293 cells using ALAS2 antibody (30539-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for ALAS2 in ?

Overview

Tested Applications
Product Information
Publications (1)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	K-562 cells, NIH/3T3 cells, mouse brain tissue, mouse heart tissue, Sp2/0 cells
Positive IF/ICC detected in	HEK-293 cells

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:500-1:3000
Immunofluorescence (IF)/ICC	IF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

30539-1-AP targets ALAS2 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity	human, mouse
Cited Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag30308 Product name: Recombinant human ALAS2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 502-574 aa of BC030230 Sequence: LLRLAPSPHHSPQMMEDFVEKLLLAWTAVGLPLQDVSVAACNFCRRPVHFELMSEWERSYFGNMGPQYVTTYA Predict reactive species
Full Name	aminolevulinate, delta-, synthase 2
Calculated Molecular Weight	587 aa, 65 kDa
Observed Molecular Weight	65 kDa
GenBank Accession Number	BC030230
Gene Symbol	ALAS2
Gene ID (NCBI)	212
RRID	AB_3086355
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	P22557
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The heme biosynthetic pathway begins from delta aminolevulinic acid synthase (ALAS) catalyzing the condensation of glycine and succinyl-CoA to delta aminolevulinic acid (ALA) in the mitochondria. ALAS is coded by two genes: ALAS1 and ALAS2 . ALAS1 is ubiquitously expressed in all cells, and the negative feedback is regulated by the heme pool; however, ALAS2 is specifically expressed only in erythroid cells.

Protocols

Product Specific Protocols
IF protocol for ALAS2 antibody 30539-1-AP	Download protocol
WB protocol for ALAS2 antibody 30539-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The ALAS2 Polyclonal antibody (Cat# 30539-1-AP) has 1 total citation. It was cited in Nature (2026) in a study titled "An ancient mitochondrial program tunes translation to haem availability," which falls within the research fields of mitochondrial biology, heme biosynthesis, and translational regulation. The antibody was used for Western blot (WB) in human samples.