Product Information
67372-1-PBS targets ALDH9A1 in WB, IHC, Indirect ELISA applications and shows reactivity with Human samples.
Tested Reactivity | Human |
Host / Isotype | Mouse / IgG1 |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag24493 Product name: Recombinant human ALDH9A1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 285-412 aa of BC151140 Sequence: LIIFSDCDMNNAVKGALMANFLTQGQVCCNGTRVFVQKEILDKFTEEVVKQTQRIKIGDPLLEDTRMGPLINRPHLERVLGFVKVAKEQGAKVLCGGDIYVPEDPKLKDGYYMRPCVLTNCRDDMTCV Predict reactive species |
Full Name | aldehyde dehydrogenase 9 family, member A1 |
Calculated Molecular Weight | 518 aa, 56 kDa |
Observed Molecular Weight | 46 kDa |
GenBank Accession Number | BC151140 |
Gene Symbol | ALDH9A1 |
Gene ID (NCBI) | 223 |
RRID | AB_2882620 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein G purification |
UNIPROT ID | P49189 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |
Background Information
Aldehyde dehydrogenase 9 family member A1(ALDH9A1), belongs to the aldehyde dehydrogenase family of proteins. ALDH9A1 has a high activity for oxidation of gamma-aminobutyraldehyde and other amino aldehydes. ALDH9A1 catalyzes the dehydrogenation of gamma-aminobutyraldehyde to gamma-aminobutyric acid. ALDH9A1 has 3 isoforms with the molecular mass of 46-56 kDa.