ALDH9A1 Monoclonal antibody, PBS Only

• 

  WB analysis of HEK-293 using 67372-1-Ig (same clone as 67372-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 67372-1-Ig (ALDH9A1 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67372-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 67372-1-Ig (same clone as 67372-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 67372-1-Ig (ALDH9A1 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67372-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 67372-1-Ig (same clone as 67372-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 67372-1-Ig (ALDH9A1 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67372-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 67372-1-Ig (same clone as 67372-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 67372-1-Ig (ALDH9A1 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67372-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 67372-1-Ig (same clone as 67372-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 67372-1-Ig (ALDH9A1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67372-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 67372-1-Ig (same clone as 67372-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 67372-1-Ig (ALDH9A1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67372-1-PBS in a different storage buffer formulation.

ALDH9A1 Monoclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 67372-1-PBS

Clone No.3C5C9

Host / Isotype

Mouse / IgG1

Reactivity

Human

Applications

WB, IHC, Indirect ELISA

Synonyms

ALDH4, ALDH7, ALDH9, ALDH9A1, E3, TMABADH

---

Product Information

67372-1-PBS targets ALDH9A1 in WB, IHC, Indirect ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24493

  Product name: Recombinant human ALDH9A1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 285-412 aa of BC151140

  Sequence: LIIFSDCDMNNAVKGALMANFLTQGQVCCNGTRVFVQKEILDKFTEEVVKQTQRIKIGDPLLEDTRMGPLINRPHLERVLGFVKVAKEQGAKVLCGGDIYVPEDPKLKDGYYMRPCVLTNCRDDMTCV

• Full Name: aldehyde dehydrogenase 9 family, member A1
• Calculated Molecular Weight: 518 aa, 56 kDa
• Observed Molecular Weight: 46 kDa
• GenBank Accession Number: BC151140
• Gene Symbol: ALDH9A1
• Gene ID (NCBI): 223
• RRID: AB_2882620
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P49189
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Aldehyde dehydrogenase 9 family member A1(ALDH9A1), belongs to the aldehyde dehydrogenase family of proteins. ALDH9A1 has a high activity for oxidation of gamma-aminobutyraldehyde and other amino aldehydes. ALDH9A1 catalyzes the dehydrogenation of gamma-aminobutyraldehyde to gamma-aminobutyric acid. ALDH9A1 has 3 isoforms with the molecular mass of 46-56 kDa.