ALDH9A1 Monoclonal antibody

• 

  WB analysis of HEK-293 using 67372-1-Ig

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 67372-1-Ig (ALDH9A1 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 67372-1-Ig

  HepG2 cells were subjected to SDS PAGE followed by western blot with 67372-1-Ig (ALDH9A1 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 67372-1-Ig

  Jurkat cells were subjected to SDS PAGE followed by western blot with 67372-1-Ig (ALDH9A1 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 67372-1-Ig

  HeLa cells were subjected to SDS PAGE followed by western blot with 67372-1-Ig (ALDH9A1 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human breast cancer using 67372-1-Ig

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 67372-1-Ig (ALDH9A1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 67372-1-Ig

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 67372-1-Ig (ALDH9A1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

ALDH9A1 Monoclonal Antibody for WB, IHC, ELISA

Cat No. 67372-1-Ig

Clone No.3C5C9

Host / Isotype

Mouse / IgG1

Reactivity

Human

Applications

WB, IHC, ELISA

Synonyms

ALDH4, ALDH7, ALDH9, ALDH9A1, E3, TMABADH

---

Tested Applications

• Positive WB detected in: HepG2 cells, HEK-293 cells, HeLa cells, Jurkat cells
• Positive IHC detected in: human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

67372-1-Ig targets ALDH9A1 in WB, IHC, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24493

  Product name: Recombinant human ALDH9A1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 285-412 aa of BC151140

  Sequence: LIIFSDCDMNNAVKGALMANFLTQGQVCCNGTRVFVQKEILDKFTEEVVKQTQRIKIGDPLLEDTRMGPLINRPHLERVLGFVKVAKEQGAKVLCGGDIYVPEDPKLKDGYYMRPCVLTNCRDDMTCV

• Full Name: aldehyde dehydrogenase 9 family, member A1
• Calculated Molecular Weight: 518 aa, 56 kDa
• Observed Molecular Weight: 46 kDa
• GenBank Accession Number: BC151140
• Gene Symbol: ALDH9A1
• Gene ID (NCBI): 223
• RRID: AB_2882620
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P49189
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Aldehyde dehydrogenase 9 family member A1(ALDH9A1), belongs to the aldehyde dehydrogenase family of proteins. ALDH9A1 has a high activity for oxidation of gamma-aminobutyraldehyde and other amino aldehydes. ALDH9A1 catalyzes the dehydrogenation of gamma-aminobutyraldehyde to gamma-aminobutyric acid. ALDH9A1 has 3 isoforms with the molecular mass of 46-56 kDa.