Tested Applications
Positive WB detected in | HepG2 cells, HEK-293 cells, HeLa cells, Jurkat cells |
Positive IHC detected in | human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:5000-1:50000 |
Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
67372-1-Ig targets ALDH9A1 in WB, IHC, ELISA applications and shows reactivity with Human samples.
Tested Reactivity | Human |
Host / Isotype | Mouse / IgG1 |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag24493 Product name: Recombinant human ALDH9A1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 285-412 aa of BC151140 Sequence: LIIFSDCDMNNAVKGALMANFLTQGQVCCNGTRVFVQKEILDKFTEEVVKQTQRIKIGDPLLEDTRMGPLINRPHLERVLGFVKVAKEQGAKVLCGGDIYVPEDPKLKDGYYMRPCVLTNCRDDMTCV Predict reactive species |
Full Name | aldehyde dehydrogenase 9 family, member A1 |
Calculated Molecular Weight | 518 aa, 56 kDa |
Observed Molecular Weight | 46 kDa |
GenBank Accession Number | BC151140 |
Gene Symbol | ALDH9A1 |
Gene ID (NCBI) | 223 |
RRID | AB_2882620 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein G purification |
UNIPROT ID | P49189 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Aldehyde dehydrogenase 9 family member A1(ALDH9A1), belongs to the aldehyde dehydrogenase family of proteins. ALDH9A1 has a high activity for oxidation of gamma-aminobutyraldehyde and other amino aldehydes. ALDH9A1 catalyzes the dehydrogenation of gamma-aminobutyraldehyde to gamma-aminobutyric acid. ALDH9A1 has 3 isoforms with the molecular mass of 46-56 kDa.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for ALDH9A1 antibody 67372-1-Ig | Download protocol |
IHC protocol for ALDH9A1 antibody 67372-1-Ig | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |