AMMECR1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• AMMECR1 Polyclonal antibody, PBS Only (24687-1-PBS)

• 

  WB analysis of Jurkat using 24687-1-AP (same clone as 24687-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 24687-1-AP (AMMECR1 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24687-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse liver using 24687-1-AP (same clone as 24687-1-PBS)

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 24687-1-AP (AMMECR1 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24687-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse uterus using 24687-1-AP (same clone as 24687-1-PBS)

  mouse uterus tissue were subjected to SDS PAGE followed by western blot with 24687-1-AP (AMMECR1 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24687-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse cerebellum using 24687-1-AP (same clone as 24687-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 24687-1-AP (AMMECR1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24687-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse cerebellum using 24687-1-AP (same clone as 24687-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 24687-1-AP (AMMECR1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24687-1-PBS in a different storage buffer formulation.

AMMECR1 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 24687-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

24687-1-PBS targets AMMECR1 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16977

  Product name: Recombinant human AMMECR1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-296 aa of BC060813

  Sequence: MAAGCCGVKKQKLSSSPPSGSGGGGGASSSSHCSGESQCRAGELGLGGAGTRLNGLGGLTGGGSGSGCTLSPPQGCGGGGGGIALSPPPSCGVGTLLSTPAAATSSSPSSSSAASSSSPGSRKMVVSAEMCCFCFDVLYCHLYGYQQPRTPRFTNEPYALKDSRFPPMTRDELPRLFCSVSLLTNFEDVCDYLDWEVGVHGIRIEFINEKGSKRTATYLPEVAKEQGWDHIQTIDSLLRKGGYKAPITNEFRKTIKLTRYRSEKMTLSYAEYLAHRQHHHFQNGIGHPLPPYNHYS

• Full Name: Alport syndrome, mental retardation, midface hypoplasia and elliptocytosis chromosomal region gene 1
• Calculated Molecular Weight: 330 aa, 35 kDa
• Observed Molecular Weight: 45 kDa
• GenBank Accession Number: BC060813
• Gene Symbol: AMMECR1
• Gene ID (NCBI): 9949
• RRID: AB_2879671
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y4X0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

AMMECR1 also named as AMME syndrome candidate gene 1 protein is a 333 amino acid protein, which contains 1 AMMECER1 domain. Containing a glycine-rich N terminus, the AMMECR1 protein exhibits putative nuclear localization and a substantial level of instability, suggesting it plays a role in regulation. The deletion of AMMECR1 gene may be involved in glomerulonephritis, sensorineural hearing loss, mental retardation, midface hypoplasia and elliptocytosis.