• Featured Product
  • KD/KO Validated

AMPK Gamma 1 Monoclonal antibody, PBS Only

AMPK Gamma 1 Monoclonal Antibody for WB, Indirect ELISA

Cat No. 67182-1-PBS
Clone No.1E11D4

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

PRKAG1, 1E11D4, 5'-AMP-activated protein kinase subunit gamma-1, AMPK gamma1, AMPK subunit gamma 1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

67182-1-PBS targets AMPK Gamma 1 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag28907

Product name: Recombinant human PRKAG1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 165-321 aa of BC000358

Sequence: LYILTHKRILKFLKLFITEFPKPEFMSKSLEELQIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDIYSKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGVLKCYLHETLETIINRLVEAEVHRLVVVDENDVVKGIVSLSDILQA

Predict reactive species
Full Name protein kinase, AMP-activated, gamma 1 non-catalytic subunit
Calculated Molecular Weight 38 kDa
Observed Molecular Weight 36-38 kDa
GenBank Accession NumberBC000358
Gene Symbol AMPK Gamma 1
Gene ID (NCBI) 5571
RRIDAB_2882478
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP54619
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Protein kinase, AMP-activated, gamma 1 non-catalytic subunit (PRKAG1, synonyms: AMPKG, MGC8666) is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an catalytic subunit, and non-catalytic and subunits. AMPK is an important energy-sensing enzyme that monitors cellular energy status. In response to cellular metabolic stresses, AMPK is activated, and thus phosphorylates and iAMP-activated protein kinase (AMPK) is a highly conserved heterotrimeric serine/threonine kinase widely characterised as a sensor of cellular energetic stress. AMPK is a heterotrimeric complex consisting of a catalytic α-subunit and two regulatory subunits (β and γ). AMPK is an important energy-sensing enzyme that monitors cellular energy status. In response to cellular metabolic stresses, AMPK is activated, and thus phosphorylates and inactivates acetyl-CoA carboxylase (ACC) and beta-hydroxy beta-methylglutaryl-CoA reductase (HMGCR), key enzymes involved in regulating de novo biosynthesis of fatty acid and cholesterol. AMPK gamma 1 is one of the gamma regulatory subunits of AMPK.

Loading...
||
New chat

Able

正在加载,请稍候...