• Featured Product
  • KD/KO Validated

AMPK Gamma 1 Monoclonal antibody

AMPK Gamma 1 Monoclonal Antibody for WB, ELISA
Cat No. 67182-1-Ig
Clone No.1E11D4

Host / Isotype

Mouse / IgG1

Reactivity

Human, mouse, rat

Applications

WB, ELISA

AMPK Gamma 1, AMPK gamma1, AMPK subunit gamma 1, AMPKG, PRKAG1

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HEK-293 cells, HepG2 cells, Jurkat cells, K-562 cells, HSC-T6 cells, PC-12 cells, NIH/3T3 cells, RAW 264.7 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:20000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

67182-1-Ig targets AMPK Gamma 1 in WB, ELISA applications and shows reactivity with Human, mouse, rat samples.

Tested Reactivity Human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag28907

Product name: Recombinant human PRKAG1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 165-321 aa of BC000358

Sequence: LYILTHKRILKFLKLFITEFPKPEFMSKSLEELQIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDIYSKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGVLKCYLHETLETIINRLVEAEVHRLVVVDENDVVKGIVSLSDILQA

Predict reactive species
Full Name protein kinase, AMP-activated, gamma 1 non-catalytic subunit
Calculated Molecular Weight 38 kDa
Observed Molecular Weight 36-38 kDa
GenBank Accession NumberBC000358
Gene Symbol AMPK Gamma 1
Gene ID (NCBI) 5571
RRIDAB_2882478
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP54619
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Protein kinase, AMP-activated, gamma 1 non-catalytic subunit (PRKAG1, synonyms: AMPKG, MGC8666) is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an catalytic subunit, and non-catalytic and subunits. AMPK is an important energy-sensing enzyme that monitors cellular energy status. In response to cellular metabolic stresses, AMPK is activated, and thus phosphorylates and iAMP-activated protein kinase (AMPK) is a highly conserved heterotrimeric serine/threonine kinase widely characterised as a sensor of cellular energetic stress. AMPK is a heterotrimeric complex consisting of a catalytic α-subunit and two regulatory subunits (β and γ). AMPK is an important energy-sensing enzyme that monitors cellular energy status. In response to cellular metabolic stresses, AMPK is activated, and thus phosphorylates and inactivates acetyl-CoA carboxylase (ACC) and beta-hydroxy beta-methylglutaryl-CoA reductase (HMGCR), key enzymes involved in regulating de novo biosynthesis of fatty acid and cholesterol. AMPK gamma 1 is one of the gamma regulatory subunits of AMPK.

Protocols

Product Specific Protocols
WB protocol for AMPK Gamma 1 antibody 67182-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

YINGJIAN (Verified Customer) (08-15-2025)

high specificity, strong/robust signal, low background, consistent results, reproducible performance, good lot-to-lot consistency

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:5000
  • Cell Tissue Type: heart
AMPK Gamma 1 Antibody Western Blot validation (1:5000 dilution) in heart (Cat no:67182-1-Ig)
Loading...
||
New chat Able
正在加载,请稍候...