• Featured Product
  • KD/KO Validated

AMPK Gamma 1 Monoclonal antibody

AMPK Gamma 1 Monoclonal Antibody for WB, ELISA

Cat No. 67182-1-Ig
Clone No.1E11D4

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, ELISA

PRKAG1, 1E11D4, 5'-AMP-activated protein kinase subunit gamma-1, AMPK gamma1, AMPK subunit gamma 1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HEK-293 cells, HepG2 cells, Jurkat cells, K-562 cells, HSC-T6 cells, PC-12 cells, NIH/3T3 cells, RAW 264.7 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:20000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

WBSee 1 publications below

Product Information

67182-1-Ig targets AMPK Gamma 1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivitymouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag28907

Product name: Recombinant human PRKAG1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 165-321 aa of BC000358

Sequence: LYILTHKRILKFLKLFITEFPKPEFMSKSLEELQIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDIYSKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGVLKCYLHETLETIINRLVEAEVHRLVVVDENDVVKGIVSLSDILQA

Predict reactive species
Full Name protein kinase, AMP-activated, gamma 1 non-catalytic subunit
Calculated Molecular Weight 38 kDa
Observed Molecular Weight 36-38 kDa
GenBank Accession NumberBC000358
Gene Symbol AMPK Gamma 1
Gene ID (NCBI) 5571
RRIDAB_2882478
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP54619
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Protein kinase, AMP-activated, gamma 1 non-catalytic subunit (PRKAG1, synonyms: AMPKG, MGC8666) is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an catalytic subunit, and non-catalytic and subunits. AMPK is an important energy-sensing enzyme that monitors cellular energy status. In response to cellular metabolic stresses, AMPK is activated, and thus phosphorylates and iAMP-activated protein kinase (AMPK) is a highly conserved heterotrimeric serine/threonine kinase widely characterised as a sensor of cellular energetic stress. AMPK is a heterotrimeric complex consisting of a catalytic α-subunit and two regulatory subunits (β and γ). AMPK is an important energy-sensing enzyme that monitors cellular energy status. In response to cellular metabolic stresses, AMPK is activated, and thus phosphorylates and inactivates acetyl-CoA carboxylase (ACC) and beta-hydroxy beta-methylglutaryl-CoA reductase (HMGCR), key enzymes involved in regulating de novo biosynthesis of fatty acid and cholesterol. AMPK gamma 1 is one of the gamma regulatory subunits of AMPK.

Protocols

Product Specific Protocols
WB protocol for AMPK Gamma 1 antibody 67182-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

Exp Mol Med

Inhibition of serotonin-Htr2b signaling in skeletal muscle mitigates obesity-induced insulin resistance

Authors - Suhyeon Park

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

YINGJIAN (Verified Customer) (08-15-2025)

high specificity, strong/robust signal, low background, consistent results, reproducible performance, good lot-to-lot consistency

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:5000
  • Cell Tissue Type: heart
AMPK Gamma 1 Antibody Western Blot validation (1:5000 dilution) in heart (Cat no:67182-1-Ig)
Loading...
||
New chat

Able

正在加载,请稍候...