AMPK Gamma 1 Monoclonal antibody, PBS Only

• 

  WB analysis using 67182-1-Ig (same clone as 67182-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67182-1-Ig (AMPK gamma 1 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Alpha Tubulin Monoclonal antibody (HRP-66031) as loading control. This data was developed using the same antibody clone with 67182-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 67182-1-Ig (same clone as 67182-1-PBS)

  WB result of AMPK Gamma 1 antibody (67182-1-Ig; 1:20000; incubated at room temperature for 1.5 hours) with sh-Control and sh-AMPK Gamma 1 transfected HEK-293 cells. This data was developed using the same antibody clone with 67182-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

AMPK Gamma 1 Monoclonal Antibody for WB, Indirect ELISA

Cat No. 67182-1-PBS

Clone No.1E11D4

Host / Isotype

Mouse / IgG1

Reactivity

Human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

AMPK Gamma 1, AMPK gamma1, AMPK subunit gamma 1, AMPKG, PRKAG1

---

Product Information

67182-1-PBS targets AMPK Gamma 1 in WB, Indirect ELISA applications and shows reactivity with Human, mouse, rat samples.

• Tested Reactivity: Human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28907

  Product name: Recombinant human PRKAG1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 165-321 aa of BC000358

  Sequence: LYILTHKRILKFLKLFITEFPKPEFMSKSLEELQIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDIYSKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGVLKCYLHETLETIINRLVEAEVHRLVVVDENDVVKGIVSLSDILQA

• Full Name: protein kinase, AMP-activated, gamma 1 non-catalytic subunit
• Calculated Molecular Weight: 38 kDa
• Observed Molecular Weight: 36-38 kDa
• GenBank Accession Number: BC000358
• Gene Symbol: AMPK Gamma 1
• Gene ID (NCBI): 5571
• RRID: AB_2882478
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P54619
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Protein kinase, AMP-activated, gamma 1 non-catalytic subunit (PRKAG1, synonyms: AMPKG, MGC8666) is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an catalytic subunit, and non-catalytic and subunits. AMPK is an important energy-sensing enzyme that monitors cellular energy status. In response to cellular metabolic stresses, AMPK is activated, and thus phosphorylates and iAMP-activated protein kinase (AMPK) is a highly conserved heterotrimeric serine/threonine kinase widely characterised as a sensor of cellular energetic stress. AMPK is a heterotrimeric complex consisting of a catalytic α-subunit and two regulatory subunits (β and γ). AMPK is an important energy-sensing enzyme that monitors cellular energy status. In response to cellular metabolic stresses, AMPK is activated, and thus phosphorylates and inactivates acetyl-CoA carboxylase (ACC) and beta-hydroxy beta-methylglutaryl-CoA reductase (HMGCR), key enzymes involved in regulating de novo biosynthesis of fatty acid and cholesterol. AMPK gamma 1 is one of the gamma regulatory subunits of AMPK.