APC1 Polyclonal antibody

• 

  WB analysis of HeLa using 21748-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 21748-1-AP (APC1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Transfected HEK-293 using 21748-1-AP

  Transfected HEK-293 cells were subjected to SDS PAGE followed by western blot with 21748-1-AP (ANAPC1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of K-562 using 21748-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 21748-1-AP (APC1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HT-1080 using 21748-1-AP

  HT-1080 cells were subjected to SDS PAGE followed by western blot with 21748-1-AP (APC1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 21748-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 21748-1-AP (APC1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 21748-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 21748-1-AP (APC1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse testis using 21748-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 21748-1-AP (APC1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse testis using 21748-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 21748-1-AP (APC1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human cervical cancer using 21748-1-AP

  Immunohistochemical analysis of paraffin-embedded human cervical cancer using 21748-1-AP (APC1 antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human cervical cancer using 21748-1-AP

  Immunohistochemical analysis of paraffin-embedded human cervical cancer using 21748-1-AP (APC1 antibody) at dilution of 1:100 (under 40x lens).

• 

  IHC staining of human stomach using 21748-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach using 21748-1-AP (APC1 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human stomach using 21748-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach using 21748-1-AP (APC1 antibody) at dilution of 1:50 (under 40x lens).

APC1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 21748-1-AP

Publications(6)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

TSG 24, Testis-specific gene 24 protein, Mitotic checkpoint regulator, Apc 1, Anaphase-promoting complex subunit 1

---

Tested Applications

• Positive WB detected in: HeLa cells, HEK-293 cells, HT-1080 cells, K-562 cells, mouse brain tissue, Transfected HEK-293 cells
• Positive IHC detected in: mouse testis tissue, human cervical cancer tissue, human stomach tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 6 publications below
• IHC: See 1 publications below

Product Information

21748-1-AP targets APC1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13399

  Product name: Recombinant human ANAPC1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1596-1944 aa of BC104902

  Sequence: STDNRYHLQALRHLYVLAAEPRLLVPVDVDTNTPCYALLEVTYKGTQWYEQTKEELMAPTLLPELHLLKQIKVKGPRYWELLIDLSKGTQHLKSILSKDGVLYVKLRAGQLSYKEDPMGWQSLLAQTVANRNSEARAFKPETISAFTSDPALLSFAEYFCKPTVNMGQKQEILDLFSSVLYECVTQETPEMLPAYIAMDQAIRRLGRREMSETSELWQIKLVLEFFSSRSHQERLQNHPKRGLFMNSEFLPVVKCTIDNTLDQWLQVGGDMCVHAYLSGQPLEESQLSMLACFLVYHSVPAPQHLPPIGLEGSTSFAELLFKFKQLKMPVRALLRLAPLLLGNPQPMVM

• Full Name: anaphase promoting complex subunit 1
• Calculated Molecular Weight: 1944 aa, 217 kDa
• Observed Molecular Weight: 200-210 kDa
• GenBank Accession Number: BC104902
• Gene Symbol: APC1
• Gene ID (NCBI): 64682
• RRID: AB_10733241
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H1A4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nat Commun; DNA replication initiation factor RECQ4 possesses a role in antagonizing DNA replication initiation; Authors - Xiaohua Xu
human	WB	Oncotarget; Screening key microRNAs for castration-resistant prostate cancer based on miRNA/mRNA functional synergistic network.; Authors - Jin Zhu
human	WB	Sci Rep; Reciprocal interaction between SIRT6 and APC/C regulates genomic stability.; Authors - Helin Wang
human	WB	Cell Rep; TRPS1 drives heterochromatic origin refiring and cancer genome evolution.; Authors - Jianguo Yang
human	WB	Cell Biosci; PATL2 mutations affect human oocyte maternal mRNA homeostasis and protein interactions in cell cycle regulation; Authors - Yin-Li Zhang
human	WB,IHC	Cancer Control; The Potential Biological Roles and Clinical Significance of Anaphase-Promoting Complex Subunit 1 in Colorectal Cancer; Authors - Yi Chen