ANK3 Polyclonal antibody

• 

  WB analysis using 27980-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27980-1-AP (ANK3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human breast cancer using 27980-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 27980-1-AP (ANK3 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 27980-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 27980-1-AP (ANK3 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 27980-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 27980-1-AP (ANK3 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 27980-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 27980-1-AP (ANK3 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of PC-3 using 27980-1-AP

  Immunofluorescent analysis of (4% PFA) fixed PC-3 cells using ANK3 antibody (27980-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

ANK3 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 27980-1-AP

Publications(6)

Host / Isotype

Rabbit / IgG

Reactivity

Human, Mouse, Rat and More (3)

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

ANK 3, ANK3, Ankyrin 3, ANKYRIN G, FLJ45464

---

Tested Applications

• Positive WB detected in: mouse brain tissue, rat brain tissue
• Positive IHC detected in: human breast cancer tissue, mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: PC-3 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 5 publications below
• IHC: See 2 publications below
• IF: See 2 publications below

Product Information

27980-1-AP targets ANK3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human, Mouse, Rat samples.

• Tested Reactivity: Human, Mouse, Rat
• Cited Reactivity: human, mouse, zebrafish
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27635

  Product name: Recombinant human ANK3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 4221-4377 aa of NM_001149

  Sequence: MGLLDRLDDSPDQCRDSITSYLKGEAGKFEANGSHTEITPEAKTKSYFPESQNDVGKQSTKETLKPKIHGSGHVEEPASPLAAYQKSLEETSKLIIEETKPCVPVSMKKMSRTSPADGKPRLSLHEEEGSSGSEQKQGEGFKVKTKKEIRHVEKKSHS

• Full Name: ankyrin 3, node of Ranvier (ankyrin G)
• Calculated Molecular Weight: 480 kDa
• Observed Molecular Weight: 160 kDa, 204 kDa
• GenBank Accession Number: NM_001149
• Gene Symbol: ANK3
• Gene ID (NCBI): 288
• RRID: AB_2881028
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q12955
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ANK3 is associated with neurodevelopment and neuronal function. It has been reported that ANK3 plays a key role in bipolar disorder. ANK3 is expressed in brain at a high level. There are several isoforms of ANK3 associated with different tissue expression and function. The immune region we selected can recognize 480 kDa, 204 kDa, 202 kDa and 111 kDa protein and 27980-1-AP detects 204 kDa isoform in SDS-PAGE. (PMID: 27217151, 28687526, 30297702, 28109561, 30046097)

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Front Immunol; A comprehensive cuproptosis score and associated gene signatures reveal prognostic and immunological features of idiopathic pulmonary fibrosis; Authors - Chuanqing Jing
zebrafish	IF	Epilepsia; kcnb1 loss of function in zebrafish causes neurodevelopmental and epileptic disorders associated with γ-aminobutyric acid dysregulation; Authors - Lauralee Robichon
human	WB	J Ovarian Res; Deciphering the molecular landscape of NMDAR-E associated ovarian teratomas: a Multi-Omics approach.; Authors - Lingwei Ma
human	WB,IHC,IF	Bioact Mater; A continuous adhesion-enhanced osteogenic pathway in artificial scaffold drives cellular infiltration and condensed mineralization for rapid bone regeneration.; Authors - Peng Yu
human	WB,IHC	Front Biosci (Landmark Ed); ANK3 Is Regulated by Recursive Splicing and Inhibits Hepatocellular Carcinoma Metastasis by Inhibiting E-Cadherin Protein Degradation.; Authors - Yuanyuan Guo
mouse	WB	J Proteomics; Hippocampal proteome comparison of infant and adult Fmr1 deficiency mice reveals adult-related changes associated with postsynaptic density.; Authors - Cui Yang