CoraLite® Plus 488-conjugated ANK3 Polyclonal antibody

ANK3 Polyclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL488-27980

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC, FC (Intra)

ANK 3, Ankyrin 3, ANKYRIN G, Ankyrin3, ANKYRING

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inPC-3 cells
Positive FC (Intra) detected inPC-3 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-27980 targets ANK3 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag27635

Product name: Recombinant human ANK3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 4221-4377 aa of NM_001149

Sequence: MGLLDRLDDSPDQCRDSITSYLKGEAGKFEANGSHTEITPEAKTKSYFPESQNDVGKQSTKETLKPKIHGSGHVEEPASPLAAYQKSLEETSKLIIEETKPCVPVSMKKMSRTSPADGKPRLSLHEEEGSSGSEQKQGEGFKVKTKKEIRHVEKKSHS

Predict reactive species
Full Name ankyrin 3, node of Ranvier (ankyrin G)
Calculated Molecular Weight 480 kDa
Observed Molecular Weight160 kDa, 204 kDa
GenBank Accession NumberNM_001149
Gene Symbol ANK3
Gene ID (NCBI) 288
RRIDAB_3084112
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ12955
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

ANK3 is associated with neurodevelopment and neuronal function. It has been reported that ANK3 plays a key role in bipolar disorder. ANK3 is expressed in brain at a high level. There are several isoforms of ANK3 associated with different tissue expression and function. The immune region we selected can recognize 480 kDa, 204 kDa, 202 kDa and 111 kDa protein and 27980-1-AP detects 204 kDa isoform in SDS-PAGE. (PMID: 27217151, 28687526, 30297702, 28109561, 30046097)

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 ANK3 antibody CL488-27980Download protocol
IF protocol for CL Plus 488 ANK3 antibody CL488-27980Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...