Tested Applications
| Positive IHC detected in | human stomach cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human lung cancer tissue, mouse pancreas tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| IHC | See 7 publications below |
| IF | See 4 publications below |
| IP | See 1 publications below |
Product Information
12652-1-AP targets TMEM16A/DOG1 in IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag3320 Product name: Recombinant human ANO1,DOG1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 541-712 aa of BC027590 Sequence: LVYLYMYSKNGTMHGFVNHTLSSFNVSDFQNGTAPNDPLDLGYEVQICRYKDYREPPWSENKYDISKDFWAVLAARLAFVIVFQNLVMFMSDFVDWVIPDIPKDISQEIHKEKVLMVELFMREEQDKQQLLETWMEKERQKDEPPCNHHNTKACPDSLGSPAPSHAYHGGVL Predict reactive species |
| Full Name | anoctamin 1, calcium activated chloride channel |
| Calculated Molecular Weight | 986 aa, 114 kDa |
| Observed Molecular Weight | 114 kDa |
| GenBank Accession Number | BC027590 |
| Gene Symbol | TMEM16A |
| Gene ID (NCBI) | 55107 |
| RRID | AB_2722560 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q5XXA6 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ANO1 also named as DOG1, ORAOV2, TAOS2 and TMEM16A, acts as a calcium-activated chloride channel. It is required for normal tracheal development. ANO1 (or DOG1) is used as an aid in the identification and diagnosis of gastrointestinal stromal tumors (GIST) within the context of an antibody panel, the patient's clinical history, and other diagnostic tests evaluated by a qualified pathologist. The immunogen is the C-terminal of ANO1. This antibody can recognize isoform1 and isoform2 of human ANO1.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for TMEM16A/DOG1 antibody 12652-1-AP | Download protocol |
| IHC protocol for TMEM16A/DOG1 antibody 12652-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Elife Gq activity- and β-arrestin-1 scaffolding-mediated ADGRG2/CFTR coupling are required for male fertility. | ||
Biomed Pharmacother Calcium-activated chloride channel is involved in the onset of diarrhea triggered by EGFR tyrosine kinase inhibitor treatment in rats. | ||
Am J Physiol Gastrointest Liver Physiol miR-128 participates in the pathogenesis of chronic constipation by regulating the p38α/M-CSF inflammatory signaling pathway. | ||
Cell Death Dis Dual role of Ca2+-activated Cl- channel transmembrane member 16A in lipopolysaccharide-induced intestinal epithelial barrier dysfunction in vitro. | ||
J Therm Biol Exposure to high ambient temperature during pre-implantation impairs embryo transport and development in the oviduct: Potential association with ANO1 downregulation. |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Shabana (Verified Customer) (07-23-2025) | I have used Tmem16a (Ano1) for IF using mouse colonic tissues. There were major concerns about this antibody in giving compromised staining, this antibody from Proteintech gave good staining in the gut tissues at 1:100 dilution. The IHC results are very promising, and I would use this to look for the expression of Tmem16a in brain and blood-brain-barrier dysfunction. Will also try for western blotting.
|
FH Shihab (Verified Customer) (09-17-2021) | I have used this for immunofluorescent stainings in a certain tissue type (cannot disclose) and despite ANO1 antibodies being notorious for such stainings (we have found only 1 other to work properly), this antibody gave very encouraging results on the first attempt at staining. With further optimisation, we should be able to get a decent staining pattern. Very impressed. I will also be trying this in various other applications. Very promising antibody.
|







