Tested Applications
Positive WB detected in | mouse brain tissue, HepG2 cells, rat brain tissue |
Positive IP detected in | mouse brain tissue |
Positive IHC detected in | human kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2400 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 1 publications below |
WB | See 3 publications below |
IHC | See 3 publications below |
IF | See 1 publications below |
IP | See 1 publications below |
Product Information
27355-1-AP targets AP50 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag26059 Product name: Recombinant human AP50 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-110 aa of BC013796 Sequence: MIGGLFIYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRSNIWLAAVTKQNVNAAMVFEFLYKMCDVMAAYFGKISEENIKNNFVLIYE Predict reactive species |
Full Name | adaptor-related protein complex 2, mu 1 subunit |
Calculated Molecular Weight | 433 aa, 49 kDa |
Observed Molecular Weight | 50 kDa |
GenBank Accession Number | BC013796 |
Gene Symbol | AP50 |
Gene ID (NCBI) | 1173 |
RRID | AB_2880853 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q96CW1 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for AP50 antibody 27355-1-AP | Download protocol |
IHC protocol for AP50 antibody 27355-1-AP | Download protocol |
IP protocol for AP50 antibody 27355-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Autophagy AP2M1 mediates autophagy-induced CLDN2 (claudin 2) degradation through endocytosis and interaction with LC3 and reduces intestinal epithelial tight junction permeability.
| ||
Cell Commun Signal SUMOylation-induced membrane localization of TRPV1 suppresses proliferation and migration in gastric cancer cells | ||
Oral Dis Expression levels of SIX1, ME2, and AP2M1 in adenoid cystic carcinoma and mucoepidermoid carcinoma. | ||
Cancer Res Lipid metabolic reprogramming extends beyond histological tumor demarcations in operable human pancreatic cancer | ||
Nat Commun Systematic HOIP interactome profiling reveals critical roles of linear ubiquitination in tissue homeostasis | ||
J Transl Med A multi-dimensional approach to unravel the intricacies of lactylation related signature for prognostic and therapeutic insight in colorectal cancer |