AP5Z1/SPG48 Monoclonal antibody, PBS Only

• 

  WB analysis using 66533-1-Ig (same clone as 66533-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66533-1-Ig (Zeta5 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66533-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 66533-1-Ig (same clone as 66533-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 66533-1-Ig (AP5Z1/SPG48 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66533-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 66533-1-Ig (same clone as 66533-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 66533-1-Ig (AP5Z1/SPG48 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66533-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HEK-293 using 66533-1-Ig (same clone as 66533-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HEK-293 cells using AP5Z1/SPG48 antibody (66533-1-Ig, Clone: 1G1D7 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1). This data was developed using the same antibody clone with 66533-1-PBS in a different storage buffer formulation.

AP5Z1/SPG48 Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 66533-1-PBS

Clone No.1G1D7

Host / Isotype

Mouse / IgG1

Reactivity

Human, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

AP-5 complex subunit zeta-1, AP5Z1, AP5Z1/SPG48, KIAA0415, SPG48, Zeta5

---

Product Information

66533-1-PBS targets AP5Z1/SPG48 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with Human, rat samples.

• Tested Reactivity: Human, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26961

  Product name: Recombinant human KIAA0415 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 260-364 aa of BC037399

  Sequence: TLDTDDRSEQEGSTLSVISATSSAGRLLPPRERLREVAFEYCQRLIEQSNRRALRKGDSDLQKACLVEAVLVLDVLCRQDPSFLYRSLSCLKALHGRVRGDPASV

• Full Name: KIAA0415
• Calculated Molecular Weight: 807 aa, 88 kDa
• Observed Molecular Weight: 88 kDa, 160 kDa
• GenBank Accession Number: BC037399
• Gene Symbol: AP5Z1/SPG48
• Gene ID (NCBI): 9907
• RRID: AB_2881896
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: O43299
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

AP5Z1, also known as SPG48 and KIAA0415, is a part of AP-5. Biallelic mutations in the AP5Z1 gene encoding the AP5Z1 subunit have been described in a small number of patients with hereditary spastic paraplegia (HSP). AP5Z1 physically interacts with other HSP proteins and that patient cells are sensitive to DNA damaging drugs.