• Featured Product
  • KD/KO Validated

APEX1 Monoclonal antibody, PBS Only (Capture)

APEX1 Monoclonal Antibody for WB, IHC, Cytometric bead array, Indirect ELISA

Cat No. 67781-1-PBS
Clone No.2B10B2

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat, pig, rabbit

Applications

WB, IHC, Cytometric bead array, Indirect ELISA

2B10B2, APE, APE1, APE-1, APEN

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

67781-1-PBS targets APEX1 as part of a matched antibody pair:

MP51503-1: 67781-1-PBS capture and 67781-2-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat, pig, rabbit
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag28552

Product name: Recombinant human APEX1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-318 aa of BC002338

Sequence: MPKRGKKGAVAEDGDELRTEPEAKKSKTAAKKNDKEAAGEGPALYEDPPDQKTSPSGKPATLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLSHQYWSAPSDKEGYSGVGLLSRQCPLKVSYGIGEEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGWRLDYFLLSHSLLPALCDSKIRSKALGSDHCPITLYLAL

Predict reactive species
Full Name APEX nuclease (multifunctional DNA repair enzyme) 1
Calculated Molecular Weight 36 kDa
Observed Molecular Weight36 kDa
GenBank Accession NumberBC002338
Gene Symbol APEX1
Gene ID (NCBI) 328
RRIDAB_2918545
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP27695
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

APEX1, also named as APE, APE1, HAP1 and REF-1, belongs to the DNA repair enzymes AP/ExoA family. It is a multifunctional protein that plays a central role in the cellular response to oxidative stress. The two major activities of APEX1 are in DNA repair and redox regulation of transcriptional factors. APEX nuclease is a DNA repair enzyme having apurinic/apyrimidinic (AP) endonuclease, 3-prime,5-prime-exonuclease, DNA 3-prime repair diesterase, and DNA 3-prime-phosphatase activities. On the other hand, APEX1 also exerts reversible nuclear redox activity to regulate DNA binding affinity and transcriptional activity of transcriptional factors by controlling the redox status of their DNA-binding domain, such as the FOS/JUN AP-1 complex after exposure to IR. APEX1 is involved in calcium-dependent down-regulation of parathyroid hormone (PTH) expression by binding to negative calcium response elements (nCaREs). When acetylated at Lys-6 and Lys-7, APEX1 stimulates the YBX1-mediated MDR1 promoter activity, leading to drug resistance. It also acts as an endoribonuclease involved in the control of single-stranded RNA metabolism. It plays a role in regulating MYC mRNA turnover by preferentially cleaving in between UA and CA dinucleotides of the MYC coding region determinant (CRD). In association with NMD1, APEX1 plays a role in the rRNA quality control process during cell cycle progression.

Loading...
||
New chat

Able

正在加载,请稍候...