Tested Applications
| Positive WB detected in | SH-SY5Y cells |
| Positive FC (Intra) detected in | SH-SY5Y cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
20341-1-AP targets APJ/APLNR in WB, IHC, IF, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, rat, rabbit |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag14138 Product name: Recombinant human APLNR protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 301-380 aa of BC032688 Sequence: NSCLNPFLYAFFDPRFRQACTSMLCCGQSRCAGTSHSSSGEKSASYSSGHSQGPGPNMGKGGEQMHEKSIPYSQETLVVD Predict reactive species |
| Full Name | apelin receptor |
| Calculated Molecular Weight | 380 aa, 43 kDa |
| Observed Molecular Weight | 43 kDa |
| GenBank Accession Number | BC032688 |
| Gene Symbol | APJ |
| Gene ID (NCBI) | 187 |
| RRID | AB_2878676 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P35414 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
APJ, also named APLNR and AGTRL1, belongs to the G-protein coupled receptor 1 family. It is a receptor for apelin coupled to G proteins that inhibit adenylate cyclase activity. APJ is an alternative coreceptor with CD4 for HIV-1 infection. It may be involved in the development of AIDS dementia. APJ is expressed abundantly in the corpus callosum and spinal cord.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for APJ/APLNR antibody 20341-1-AP | Download protocol |
| WB protocol for APJ/APLNR antibody 20341-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The APJ/APLNR Polyclonal antibody (Cat# 20341-1-AP) has 56 citations spanning journals including Cell, Nature Communications, Immunity, Science Translational Medicine, Cell Metabolism, FASEB Journal, Free Radical Biology and Medicine, and Cell Death & Disease. Research fields covered include cardiovascular disease, neuroprotection and stroke, diabetes and nephropathy, inflammation and fibrosis, oncology, bone metabolism, wound healing, and reproductive biology.
| Species | Application | Title |
|---|---|---|
Cell Metab Single-Cell RNA Sequencing Maps Endothelial Metabolic Plasticity in Pathological Angiogenesis. | ||
Immunity Single-cell atlas of endothelial and mural cells across primary and metastatic brain tumors | ||
Nat Commun Targeting APLN/APJ restores blood-testis barrier and improves spermatogenesis in murine and human diabetic models | ||
J Adv Res Targeting APJ drives BNIP3-PINK1-PARKIN induced mitophagy and improves systemic inflammatory bone loss |
Reviews
What customers say
One verified review rates this antibody 4 out of 5 stars. The reviewer used it for Western Blot on HEK cells at a 1:500 dilution (lot 00098016) and reported satisfactory performance, though no detailed written comments were provided.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Nicole (Verified Customer) (02-24-2022) |
|
