Tested Applications
Positive WB detected in | SH-SY5Y cells |
Positive FC (Intra) detected in | SH-SY5Y cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 3 publications below |
WB | See 35 publications below |
IHC | See 9 publications below |
IF | See 15 publications below |
Product Information
20341-1-AP targets APJ/APLNR in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Cited Reactivity | human, mouse, rat, rabbit |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag14138 Product name: Recombinant human APLNR protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 301-380 aa of BC032688 Sequence: NSCLNPFLYAFFDPRFRQACTSMLCCGQSRCAGTSHSSSGEKSASYSSGHSQGPGPNMGKGGEQMHEKSIPYSQETLVVD Predict reactive species |
Full Name | apelin receptor |
Calculated Molecular Weight | 380 aa, 43 kDa |
Observed Molecular Weight | 43 kDa |
GenBank Accession Number | BC032688 |
Gene Symbol | APJ |
Gene ID (NCBI) | 187 |
RRID | AB_2878676 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P35414 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
APJ, also named APLNR and AGTRL1, belongs to the G-protein coupled receptor 1 family. It is a receptor for apelin coupled to G proteins that inhibit adenylate cyclase activity. APJ is an alternative coreceptor with CD4 for HIV-1 infection. It may be involved in the development of AIDS dementia. APJ is expressed abundantly in the corpus callosum and spinal cord.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for APJ/APLNR antibody 20341-1-AP | Download protocol |
FC protocol for APJ/APLNR antibody 20341-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Immunity Single-cell atlas of endothelial and mural cells across primary and metastatic brain tumors | ||
Cell Metab Single-Cell RNA Sequencing Maps Endothelial Metabolic Plasticity in Pathological Angiogenesis. | ||
Sci Transl Med Apelin stimulation of the vascular skeletal muscle stem cell niche enhances endogenous repair in dystrophic mice | ||
Int J Nanomedicine Apelin-13-Loaded Macrophage Membrane-Encapsulated Nanoparticles for Targeted Ischemic Stroke Therapy via Inhibiting NLRP3 Inflammasome-Mediated Pyroptosis | ||
Free Radic Biol Med The Elabela-APJ axis attenuates sepsis-induced myocardial dysfunction by reducing pyroptosis by balancing the formation and degradation of autophagosomes |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Nicole (Verified Customer) (02-24-2022) |
|