Product Information
84239-1-PBS targets APOBEC3A as part of a matched antibody pair:
MP01122-1: 84239-1-PBS capture and 84239-5-PBS detection (validated in Cytometric bead array)
MP01122-2: 84239-1-PBS capture and 84239-4-PBS detection (validated in Cytometric bead array)
Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Recombinant |
Type | Antibody |
Immunogen |
CatNo: Ag18845 Product name: Recombinant human APOBEC3A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-61 aa of BC126416 Sequence: MEASPASGPRHLMDPHIFTSNFNNGIGRHKTYLCYEVERLDNGTSVKMDQHRGFLHNQAKN Predict reactive species |
Full Name | apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3A |
Calculated Molecular Weight | 199 aa, 23 kDa |
GenBank Accession Number | BC126416 |
Gene Symbol | APOBEC3A |
Gene ID (NCBI) | 200315 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | P31941 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |