APOBEC3A Recombinant monoclonal antibody, PBS Only (Detector)

APOBEC3A Uni-rAb® Recombinant Antibody for WB, IF/ICC, FC (Intra), Cytometric bead array, Indirect ELISA
Cat No. 84239-4-PBS
Clone No.241529G4

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, IF/ICC, FC (Intra), Cytometric bead array, Indirect ELISA

241529G4, A3A, ARP3, DNA dC->dU-editing enzyme APOBEC-3A, EC:3.5.4.38

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84239-4-PBS targets APOBEC3A as part of a matched antibody pair:

MP01122-2: 84239-1-PBS capture and 84239-4-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag18845

Product name: Recombinant human APOBEC3A protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-61 aa of BC126416

Sequence: MEASPASGPRHLMDPHIFTSNFNNGIGRHKTYLCYEVERLDNGTSVKMDQHRGFLHNQAKN

Predict reactive species
Full Name apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3A
Calculated Molecular Weight 199 aa, 23 kDa
Observed Molecular Weight28 kDa
GenBank Accession NumberBC126416
Gene Symbol APOBEC3A
Gene ID (NCBI) 200315
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP31941
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

APOBEC3A, also known as A3A, belongs to the cytidine and deoxycytidylate deaminase family. APOBEC3A plays a role in immunity, by restricting transmission of foreign DNA such as viruses. One mechanism of foreign DNA restriction is deamination of foreign double-stranded DNA cytidines to uridines, which leads to DNA degradation. However, other mechanisms are also thought to be involved, as anti-viral effect is not dependent on deaminase activity. APOBEC3A is expressed in several cell types, including keratinocytes and myeloid cells (PMID: 28825669). APOBEC3A has 2 isoforms with the molecular mass of 22 and 23 kDa.

Loading...
||
New chat Able
正在加载,请稍候...