Tested Applications
| Positive WB detected in | rat colon tissue, HeLa cells, HaCaT cells |
| Positive IF/ICC detected in | THP-1 cells |
| Positive FC (Intra) detected in | A431 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
84239-4-RR targets APOBEC3A in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, rat samples.
| Tested Reactivity | human, rat |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag18845 Product name: Recombinant human APOBEC3A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-61 aa of BC126416 Sequence: MEASPASGPRHLMDPHIFTSNFNNGIGRHKTYLCYEVERLDNGTSVKMDQHRGFLHNQAKN Predict reactive species |
| Full Name | apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3A |
| Calculated Molecular Weight | 199 aa, 23 kDa |
| Observed Molecular Weight | 28 kDa |
| GenBank Accession Number | BC126416 |
| Gene Symbol | APOBEC3A |
| Gene ID (NCBI) | 200315 |
| RRID | AB_3671792 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P31941 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
APOBEC3A, also known as A3A, belongs to the cytidine and deoxycytidylate deaminase family. APOBEC3A plays a role in immunity, by restricting transmission of foreign DNA such as viruses. One mechanism of foreign DNA restriction is deamination of foreign double-stranded DNA cytidines to uridines, which leads to DNA degradation. However, other mechanisms are also thought to be involved, as anti-viral effect is not dependent on deaminase activity. APOBEC3A is expressed in several cell types, including keratinocytes and myeloid cells (PMID: 28825669). APOBEC3A has 2 isoforms with the molecular mass of 22 and 23 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for APOBEC3A antibody 84239-4-RR | Download protocol |
| WB protocol for APOBEC3A antibody 84239-4-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The APOBEC3A Recombinant monoclonal antibody (241529G4), catalog number 84239-4-RR, has a total of 1 citation. It appears in Cardiovascular Toxicology (Impact Factor: 3.3), published in 2026. The cited study investigates sex-specific associations between cadmium exposure and mortality risk in cardiovascular disease patients, integrating molecular mechanisms of myocardial dysfunction. The research field encompasses cardiovascular toxicology, environmental exposure (cadmium), and cardiac pathology. The antibody was used in Western Blot on human samples.
| Species | Application | Title |
|---|---|---|
Cardiovasc Toxicol Sex-Specific Associations Between Cadmium Exposure and Mortality Risk in Cardiovascular Disease Patients: A Cohort Study Integrating Molecular Mechanisms of Myocardial Dysfunction. |
