Tested Applications
| Positive WB detected in | mouse skeletal muscle tissue, human heart tissue, rat skeletal muscle, mouse kidney, rat kidney |
| Positive IP detected in | mouse kidney tissue, mouse skeletal muscle tissue |
| Positive IHC detected in | mouse kidney tissue, human breast cancer tissue, human kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human breast cancer tissue, mouse kidney tissue |
| Positive IF-Fro detected in | mouse breast cancer |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:3000-1:12000 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Immunofluorescence (IF)-FRO | IF-FRO : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below |
| WB | See 40 publications below |
| IHC | See 29 publications below |
| IF | See 29 publications below |
| IP | See 2 publications below |
| FC | See 2 publications below |
Product Information
20333-1-AP targets AQP1 in WB, IHC, IF-P, IF-Fro, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig, canine, bovine, goat, horse, cat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag14093 Product name: Recombinant human AQP1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 220-269 aa of BC022486 Sequence: GALAVLIYDFILAPRSSDLTDRVKVWTSGQVEEYDLDADDINSRVEMKPK Predict reactive species |
| Full Name | aquaporin 1 (Colton blood group) |
| Calculated Molecular Weight | 269 aa, 29 kDa |
| Observed Molecular Weight | 25-28 kDa, 35-50 kDa |
| GenBank Accession Number | BC022486 |
| Gene Symbol | AQP1 |
| Gene ID (NCBI) | 358 |
| RRID | AB_10666159 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P29972 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
AQP1 is a member of aquaporins (AQPs) that are small membrane-spanning proteins facilitating water transport. AQP1 is expressed in most tissues in the mammalian body. Alterations of AQP1 expression have been linked to variety of diseases, including cancer. The predicted molecular weight of AQP1 is around 28 kDa, while highly glycosylated form can also be observed around 35-50 kDa. (PMID:20965731,16508653, 1530176).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for AQP1 antibody 20333-1-AP | Download protocol |
| IHC protocol for AQP1 antibody 20333-1-AP | Download protocol |
| IP protocol for AQP1 antibody 20333-1-AP | Download protocol |
| WB protocol for AQP1 antibody 20333-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
J Extracell Vesicles Quantification of urinary podocyte-derived migrasomes for the diagnosis of kidney disease | ||
Theranostics Histone H3K27 methyltransferase EZH2 regulates apoptotic and inflammatory responses in sepsis-induced AKI | ||
Proc Natl Acad Sci U S A Direct visualization of the arterial wall water permeability barrier using CARS microscopy. | ||
Proc Natl Acad Sci U S A Gut sulfide metabolism modulates behavior and brain bioenergetics |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH MALLIKARJUNA (Verified Customer) (10-24-2025) | WORKS BEST FOR WESTERN
|



























