Tested Applications
| Positive WB detected in | 37°C incubated mouse kidney tissue |
| Positive IHC detected in | mouse kidney tissue, human kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse kidney tissue |
| Positive IF-Fro detected in | mouse kidney tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Immunofluorescence (IF)-FRO | IF-FRO : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 1 publications below |
| IHC | See 1 publications below |
| IF | See 4 publications below |
Product Information
29386-1-AP targets AQP2 in WB, IHC, IF-P, IF-Fro, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag29931 Product name: Recombinant human AQP2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 207-271 aa of NM_000486 Sequence: GPLVGAILGSLLYNYVLFPPAKSLSERLAVLKGLEPDTDWEEREVRRRQSVELHSPQSLPRGTKA Predict reactive species |
| Full Name | aquaporin 2 (collecting duct) |
| Calculated Molecular Weight | 29 kDa |
| Observed Molecular Weight | 28-29, 35-38 kDa |
| GenBank Accession Number | NM_000486 |
| Gene Symbol | AQP2 |
| Gene ID (NCBI) | 359 |
| RRID | AB_2918288 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P41181 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
AQP2 (Aquaporin2) is a water channel protein that is widely distributed among mammalian tissues and plays a major role in water homeostasis. AQP2 is mainly found in the apical cell membranes of the kidney's collecting duct cells and is critical for urinary concentration. AQP2 can be glycosylated and this antibody recognizes the 28-29 kDa non-glycosylated as well as the 35-40 kDa glycosylated forms of AQP2.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for AQP2 antibody 29386-1-AP | Download protocol |
| IHC protocol for AQP2 antibody 29386-1-AP | Download protocol |
| WB protocol for AQP2 antibody 29386-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
FASEB J Circadian rhythm disruptions exacerbate inner ear damage in a murine endolymphatic hydrops model | ||
Environ Pollut Ozone exposure induced kidney damage in diabetic mice: the key role of lipid metabolism and water-electrolyte homeostasis | ||
Research (Wash D C) Single-Cell RNA Sequencing Analysis Reveals the Role of Macrophage-Mediated CD44-AKT-CCL2 Pathways in Renal Tubule Injury during Calcium Oxalate Crystal Formation | ||
EMBO Mol Med Melanin-like nanoparticles slow cyst growth in ADPKD by dual inhibition of oxidative stress and CREB | ||
Diabetes Metab J Kidney Gastrin/CCKBR Attenuates Type 2 Diabetes Mellitus by Inhibiting SGLT2-Mediated Glucose Reabsorption through Erk/NF-κB Signaling Pathway |









