Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

Aquaporin 4 Polyclonal antibody

Aquaporin 4 Polyclonal Antibody for WB, IHC, IF-P, IF-Fro, IP, ELISA

Cat No. 16473-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (3)

Applications

WB, IHC, IF-P, IF-Fro, IP, ELISA

AQP4, AQP 4, AQP-4, Aquaporin4, Aquaporin-4

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse liver tissue, SKOV-3 cells, mouse kidney tissue, mouse heart tissue, mouse brain tissue, rat brain tissue, rat heart tissue
Positive IP detected inmouse brain tissue
Positive IHC detected inmouse brain tissue, human brain tissue, rat brain tissue, mouse heart tissue, human kidney tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inrat brain tissue, mouse brain tissue
Positive IF-Fro detected inmouse brain tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:100-1:2500
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Immunofluorescence (IF)-FROIF-FRO : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

16473-1-AP targets Aquaporin 4 in WB, IHC, IF-P, IF-Fro, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, pig, monkey, chicken
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag9561

Product name: Recombinant human AQP4 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 208-323 aa of BC022286

Sequence: TGASMNPARSFGPAVIMGNWENHWIYWVGPIIGAVLAGGLYEYVFCPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVLSSV

Predict reactive species
Full Name Aquaporin 4
Calculated Molecular Weight 323 aa, 35 kDa
Observed Molecular Weight 35-37 kDa, 32-34 kDa
GenBank Accession NumberBC022286
Gene Symbol Aquaporin 4
Gene ID (NCBI) 361
RRIDAB_2827426
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP55087
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Aquaporins are specialized water transport channels in plasma membranes of water-permeable tissues. Aquaporin-4 (AQP4) is the most abundant water channel in the human central nervous system and is important to fluid movements in brain. Aquaporin-4 exists as two isoforms, a long (M1) isoform with translation initiation at Met-1, and a shorter (M23) isoform with translation initiation at Met-23, with molecular weights around 35-37 kDa and 32-34 kDa, respectively.

Protocols

Product Specific Protocols
IF protocol for Aquaporin 4 antibody 16473-1-APDownload protocol
IHC protocol for Aquaporin 4 antibody 16473-1-APDownload protocol
IP protocol for Aquaporin 4 antibody 16473-1-APDownload protocol
WB protocol for Aquaporin 4 antibody 16473-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
WB

J Clin Invest

MicroRNA-26a-3p rescues depression-like behaviors in male rats via preventing hippocampal neuronal anomalies.

Authors - Ye Li
humanIF

Clin Cancer Res

A Histopathologic Correlation Study Evaluating Glymphatic Function in Brain Tumors by Multi-Parametric MRI

Authors - Min Gao
humanIF

Brain

Frontal white matter hyperintensities, clasmatodendrosis and gliovascular abnormalities in ageing and post-stroke dementia.

Authors - Aiqing Chen
IF

Acta Pharmacol Sin

β-Hydroxybutyrate improves glymphatic system function and alleviates cerebral edema in mice after ischemic stroke

Authors - Ming-Jia Yu
mouseWB,IF

Brain Behav Immun

Polyunsaturated fatty acid supplement alleviates depression-incident cognitive dysfunction by protecting the cerebrovascular and glymphatic systems.

Authors - Xinghua Liu
mouseWB

Glia

Haploinsufficiency of microglial MyD88 ameliorates Alzheimer's pathology and vascular disorders in APP/PS1-transgenic mice.

Authors - Wenqiang Quan

Reviews

    4.7 out of 5
Add a review

4 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


GARGI (Verified Customer) (08-07-2025)

Nice and clear staining using this antibody

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:750
  • Cell Tissue Type: Neurons

Paula (Verified Customer) (07-30-2024)

Worked well for human primary cell line, dilution used 1:500 (secondary 1:400)

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: Human
Aquaporin 4 Antibody Immunofluorescence validation (1:500 dilution) in Human (Cat no:16473-1-AP)

aidan (Verified Customer) (07-27-2024)

Very happy with this antibody would highly recommend. Overnight 4degrees, 1:2000. Bis tris gel. Secondary 1:4000 HRP 1h RT.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:2000
  • Cell Tissue Type: muller retinal mouse
Aquaporin 4 Antibody Western Blot validation (1:2000 dilution) in muller retinal mouse (Cat no:16473-1-AP)

Reyes (Verified Customer) (04-05-2024)

Aquaporin 4 (in green) shows a strong stainning, although difficult for the analyses, in human FFPE brain cortex.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: Human Brain Cortex
Aquaporin 4 Antibody Immunofluorescence validation (1:100 dilution) in Human Brain Cortex (Cat no:16473-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...