Filter: AllWBIPIHCIF-P

WB analysis using 16473-1-AP (same clone as 16473-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 16473-1-AP (Aquaporin 4 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16473-1-PBS in a different storage buffer formulation.
WB analysis using 16473-1-AP (same clone as 16473-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 16473-1-AP (Aquaporin 4 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16473-1-PBS in a different storage buffer formulation.
WB analysis of mouse heart using 16473-1-AP (same clone as 16473-1-PBS)
mouse heart tissue were subjected to SDS PAGE followed by western blot with 16473-1-AP (Aquaporin 4 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16473-1-PBS in a different storage buffer formulation.
WB analysis of SKOV-3 using 16473-1-AP (same clone as 16473-1-PBS)
SKOV-3 cells were subjected to SDS PAGE followed by western blot with 16473-1-AP (Aquaporin 4 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16473-1-PBS in a different storage buffer formulation.
WB analysis of mouse kidney using 16473-1-AP (same clone as 16473-1-PBS)
mouse kidney tissue were subjected to SDS PAGE followed by western blot with 16473-1-AP (Aquaporin 4 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16473-1-PBS in a different storage buffer formulation.
IP experiment of mouse heart using 16473-1-AP (same clone as 16473-1-PBS)
IP result of anti-Aquaporin 4 (IP:16473-1-AP, 4ug; Detection:16473-1-AP 1:300) with mouse heart tissue lysate 4000ug. This data was developed using the same antibody clone with 16473-1-PBS in a different storage buffer formulation.
IHC staining of mouse brain using 16473-1-AP (same clone as 16473-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 16473-1-AP (Aquaporin 4 antibody) at dilution of 1:2000 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16473-1-PBS in a different storage buffer formulation.
IHC staining of mouse brain using 16473-1-AP (same clone as 16473-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 16473-1-AP (Aquaporin 4 antibody) at dilution of 1:2000 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16473-1-PBS in a different storage buffer formulation.
IHC staining of rat brain using 16473-1-AP (same clone as 16473-1-PBS)
Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 16473-1-AP (Aquaporin 4 antibody) at dilution of 1:400 (under 10x lens). This data was developed using the same antibody clone with 16473-1-PBS in a different storage buffer formulation.
IHC staining of rat brain using 16473-1-AP (same clone as 16473-1-PBS)
Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 16473-1-AP (Aquaporin 4 antibody) at dilution of 1:400 (under 40x lens). This data was developed using the same antibody clone with 16473-1-PBS in a different storage buffer formulation.
IHC staining of mouse heart using 16473-1-AP (same clone as 16473-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse heart using 16473-1-AP (Aquaporin 4 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 16473-1-PBS in a different storage buffer formulation.
IHC staining of mouse heart using 16473-1-AP (same clone as 16473-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse heart using 16473-1-AP (Aquaporin 4 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 16473-1-PBS in a different storage buffer formulation.
IHC staining of human kidney using 16473-1-AP (same clone as 16473-1-PBS)
Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 16473-1-AP (Aquaporin 4 antibody at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 16473-1-PBS in a different storage buffer formulation.
IHC staining of human kidney using 16473-1-AP (same clone as 16473-1-PBS)
Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 16473-1-AP (Aquaporin 4 antibody at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 16473-1-PBS in a different storage buffer formulation.
IHC staining of human brain using 16473-1-AP (same clone as 16473-1-PBS)
Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 16473-1-AP (Aquaporin 4 antibody at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 16473-1-PBS in a different storage buffer formulation.
IHC staining of human brain using 16473-1-AP (same clone as 16473-1-PBS)
Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 16473-1-AP (Aquaporin 4 antibody at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 16473-1-PBS in a different storage buffer formulation.
IF Staining of mouse brain using 16473-1-AP (same clone as 16473-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using Aquaporin 4 antibody (16473-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), GFAP antibody (60190-1-Ig, Clone: 4B2E10, red). This data was developed using the same antibody clone with 16473-1-PBS in a different storage buffer formulation.
IF Staining of rat brain using 16473-1-AP (same clone as 16473-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed rat brain tissue using Aquaporin 4 antibody (16473-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), GFAP antibody (60190-1-Ig, Clone: 4B2E10, red). This data was developed using the same antibody clone with 16473-1-PBS in a different storage buffer formulation.

Featured Product
KD/KO Validated

Aquaporin 4 Polyclonal antibody, PBS Only

Aquaporin 4 Polyclonal Antibody for WB, IHC, IF-P, IP, ELISA

Cat No. 16473-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, IP, ELISA

Synonyms

AQP4, AQP 4, AQP-4, Aquaporin4, Aquaporin-4

Formulation: PBS Only

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

16473-1-PBS targets Aquaporin 4 in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag9561 Product name: Recombinant human AQP4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 208-323 aa of BC022286 Sequence: TGASMNPARSFGPAVIMGNWENHWIYWVGPIIGAVLAGGLYEYVFCPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVLSSV Predict reactive species
Full Name	Aquaporin 4
Calculated Molecular Weight	323 aa, 35 kDa
Observed Molecular Weight	35-37 kDa, 32-34 kDa
GenBank Accession Number	BC022286
Gene Symbol	Aquaporin 4
Gene ID (NCBI)	361
RRID	AB_2827426
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	P55087
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

Aquaporins are specialized water transport channels in plasma membranes of water-permeable tissues. Aquaporin-4 (AQP4) is the most abundant water channel in the human central nervous system and is important to fluid movements in brain. Aquaporin-4 exists as two isoforms, a long (M1) isoform with translation initiation at Met-1, and a shorter (M23) isoform with translation initiation at Met-23, with molecular weights around 35-37 kDa and 32-34 kDa, respectively.