CoraLite®594-conjugated Aquaporin 4 Polyclonal antibody

• 

  IF Staining of rat brain using CL594-16473

  Immunofluorescent analysis of (4% PFA) fixed rat brain tissue using CoraLite®594 Aquaporin 4 antibody (CL594-16473) at dilution of 1:200.

• 

  IF Staining of mouse brain using CL594-16473

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using CoraLite®594 Aquaporin 4 antibody (CL594-16473) at dilution of 1:200.

• Featured Product
• KD/KO Validated

Aquaporin 4 Polyclonal Antibody for IF-P

Cat No. CL594-16473

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF-P

Synonyms

AQP 4, AQP4, aquaporin 4, HMIWC2, MIWC, WCH4

---

Tested Applications

• Positive IF-P detected in: rat brain tissue, mouse brain tissue

Recommended dilution

• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL594-16473 targets Aquaporin 4 in IF-P applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9561

  Product name: Recombinant human AQP4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 208-323 aa of BC022286

  Sequence: TGASMNPARSFGPAVIMGNWENHWIYWVGPIIGAVLAGGLYEYVFCPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVLSSV

• Full Name: Aquaporin 4
• Calculated Molecular Weight: 323 aa, 35 kDa
• Observed Molecular Weight: 35-37 kDa, 32-34 kDa
• GenBank Accession Number: BC022286
• Gene Symbol: Aquaporin 4
• Gene ID (NCBI): 361
• RRID: AB_2919831
• Conjugate: CoraLite®594 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 588 nm / 604 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P55087
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Aquaporins are specialized water transport channels in plasma membranes of water-permeable tissues. Aquaporin-4 (AQP4) is the most abundant water channel in the human central nervous system and is important to fluid movements in brain. Aquaporin-4 exists as two isoforms, a long (M1) isoform with translation initiation at Met-1, and a shorter (M23) isoform with translation initiation at Met-23, with molecular weights around 35-37 kDa and 32-34 kDa, respectively.