Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

CoraLite® Plus 647-conjugated Aquaporin 4 Polyclonal antibody

Aquaporin 4 Polyclonal Antibody for IF-P

Cat No. CL647-16473

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF-P

AQP 4, AQP4, aquaporin 4, HMIWC2, MIWC, WCH4

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inmouse brain tissue

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

IFSee 4 publications below

Product Information

CL647-16473 targets Aquaporin 4 in IF-P applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivitymouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag9561

Product name: Recombinant human AQP4 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 208-323 aa of BC022286

Sequence: TGASMNPARSFGPAVIMGNWENHWIYWVGPIIGAVLAGGLYEYVFCPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVLSSV

Predict reactive species
Full Name Aquaporin 4
Calculated Molecular Weight 323 aa, 35 kDa
Observed Molecular Weight 35-37 kDa, 32-34 kDa
GenBank Accession NumberBC022286
Gene Symbol Aquaporin 4
Gene ID (NCBI) 361
RRIDAB_2920230
Conjugate CoraLite® Plus 647 Fluorescent Dye
Excitation/Emission Maxima Wavelengths654 nm / 674 nm
Excitation LaserRed Laser (633 nm)
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP55087
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Aquaporins are specialized water transport channels in plasma membranes of water-permeable tissues. Aquaporin-4 (AQP4) is the most abundant water channel in the human central nervous system and is important to fluid movements in brain. Aquaporin-4 exists as two isoforms, a long (M1) isoform with translation initiation at Met-1, and a shorter (M23) isoform with translation initiation at Met-23, with molecular weights around 35-37 kDa and 32-34 kDa, respectively.

Protocols

Product Specific Protocols
IF protocol for CL Plus 647 Aquaporin 4 antibody CL647-16473Download protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseIF

Adv Mater

Noninvasive Optogenetics Realized by iPSC-Derived Tentacled Carrier in Alzheimer's Disease Treatment

Authors - Yuewen Zhai
IF

Front Neurosci

Stress in utero: prenatal dexamethasone exposure causes greater structural gliovascular alterations in female offspring than in males

Authors - Magda Ferreira-Rodrigues
mouseIF

Cell Rep

Integrative multi-omic profiling of adult mouse brain endothelial cells and potential implications in Alzheimer's disease

Authors - Min Yu
mouseIF

J Clin Invest

APOE-ε4 synergizes with sleep disruption to accelerate Aβ deposition and Aβ-associated tau seeding and spreading

Authors - Chanung Wang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Aito (Verified Customer) (10-02-2025)

We used this item and were very satisfied with the results. The staining is included antigen retrieval of heating 30 minutes by steamer.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1/100
  • Cell Tissue Type: human brain glioblastoma
CL Plus 647 Aquaporin 4 Antibody Immunofluorescence validation (1/100 dilution) in human brain glioblastoma (Cat no:CL647-16473)
FH

Aito (Verified Customer) (05-27-2025)

Aquaporin 4 and DAPI in a slide of human glioblastoma sample.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1/100
  • Cell Tissue Type: human brain glioblastoma
CL Plus 647 Aquaporin 4 Antibody Immunofluorescence validation (1/100 dilution) in human brain glioblastoma (Cat no:CL647-16473)
FH

Vanessa (Verified Customer) (09-27-2023)

Works Perfectly!

  • Applications: Immunohistochemistry, Immunofluorescence
  • Primary Antibody Dilution: 1:200
  • Cell Tissue Type: Brain
Loading...
||
New chat

Able

正在加载,请稍候...