Tested Applications
| Positive IF-P detected in | mouse brain tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL647-16473 targets Aquaporin 4 in IF-P applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag9561 Product name: Recombinant human AQP4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 208-323 aa of BC022286 Sequence: TGASMNPARSFGPAVIMGNWENHWIYWVGPIIGAVLAGGLYEYVFCPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVLSSV Predict reactive species |
| Full Name | Aquaporin 4 |
| Calculated Molecular Weight | 323 aa, 35 kDa |
| Observed Molecular Weight | 35-37 kDa, 32-34 kDa |
| GenBank Accession Number | BC022286 |
| Gene Symbol | Aquaporin 4 |
| Gene ID (NCBI) | 361 |
| RRID | AB_2920230 |
| Conjugate | CoraLite® Plus 647 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 654 nm / 674 nm |
| Excitation Laser | Red Laser (633 nm) |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P55087 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Aquaporins are specialized water transport channels in plasma membranes of water-permeable tissues. Aquaporin-4 (AQP4) is the most abundant water channel in the human central nervous system and is important to fluid movements in brain. Aquaporin-4 exists as two isoforms, a long (M1) isoform with translation initiation at Met-1, and a shorter (M23) isoform with translation initiation at Met-23, with molecular weights around 35-37 kDa and 32-34 kDa, respectively.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CL Plus 647 Aquaporin 4 antibody CL647-16473 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Aquaporin 4 (AQP4) Polyclonal Antibody (CL647-16473) has 4 citations published in Advanced Materials, Journal of Clinical Investigation, Cell Reports, and Frontiers in Neuroscience. The associated research fields include Alzheimer's disease treatment via optogenetics, Aβ deposition and tau spreading mechanisms, adult mouse brain endothelial cell multi-omic profiling, and prenatal stress-induced gliovascular alterations.
| Species | Application | Title |
|---|---|---|
Adv Mater Noninvasive Optogenetics Realized by iPSC-Derived Tentacled Carrier in Alzheimer's Disease Treatment | ||
J Clin Invest APOE-ε4 synergizes with sleep disruption to accelerate Aβ deposition and Aβ-associated tau seeding and spreading | ||
Cell Rep Integrative multi-omic profiling of adult mouse brain endothelial cells and potential implications in Alzheimer's disease | ||
Front Neurosci Stress in utero: prenatal dexamethasone exposure causes greater structural gliovascular alterations in female offspring than in males |
Reviews
What customers say
All three reviewers gave this product a perfect 5-star rating. A researcher used it at 1/100 dilution for immunofluorescence on human glioblastoma tissue with heat-based antigen retrieval (30 minutes by steamer), reporting very satisfactory staining results and clear Aquaporin 4 signal alongside DAPI counterstain. Another user confirmed excellent performance for both IHC and IF on brain tissue at 1:200 dilution, simply stating it "works perfectly." Overall, users report reliable specificity and strong signal in neural tissue applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Aito (Verified Customer) (10-02-2025) | We used this item and were very satisfied with the results. The staining is included antigen retrieval of heating 30 minutes by steamer.
 |
Aito (Verified Customer) (05-27-2025) | Aquaporin 4 and DAPI in a slide of human glioblastoma sample.
 |
Vanessa (Verified Customer) (09-27-2023) | Works Perfectly!
|
