Tested Applications
| Positive WB detected in | pig brain tissue, rat spinal cord tissue, rabbit brain tissue, rat brain tissue, mouse brain tissue |
| Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:2000-1:8000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
68448-1-Ig targets Aquaporin 4 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.
| Tested Reactivity | human, mouse, rat, pig, rabbit |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Mouse / IgG2b |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag9830 Product name: Recombinant human AQP4 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 208-323 aa of BC022286 Sequence: TGASMNPARSFGPAVIMGNWENHWIYWVGPIIGAVLAGGLYEYVFCPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVLSSV Predict reactive species |
| Full Name | Aquaporin 4 |
| Calculated Molecular Weight | 323 aa, 35 kDa |
| Observed Molecular Weight | 35-37 kDa |
| GenBank Accession Number | BC022286 |
| Gene Symbol | Aquaporin 4 |
| Gene ID (NCBI) | 361 |
| RRID | AB_3085160 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P55087 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Aquaporins are specialized water transport channels in plasma membranes of water-permeable tissues. Aquaporin-4 (AQP4) is the most abundant water channel in the human central nervous system and is important to fluid movements in brain. Aquaporin-4 exists as two isoforms, a long (M1) isoform with translation initiation at Met-1, and a shorter (M23) isoform with translation initiation at Met-23, with molecular weights around 35-37 kDa and 32-34 kDa, respectively.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for Aquaporin 4 antibody 68448-1-Ig | Download protocol |
| WB protocol for Aquaporin 4 antibody 68448-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The Aquaporin 4 Monoclonal Antibody (3G7D3), catalog number 68448-1-Ig, has 4 total citations. These appear in Advanced Science, Journal of Ethnopharmacology, International Journal of Molecular Sciences, and Frontiers in Pharmacology. The cited research spans neurology and neuroscience fields, focusing on post-stroke edema, high-altitude cerebral edema, neuroprotection, ferroptosis, oxidative stress, and neuroinflammation. All four citations used the antibody for Western blot (WB) in mouse, rat, and human samples.
| Species | Application | Title |
|---|---|---|
Adv Sci (Weinh) Amelioration of Post-Stroke Edema and Microcirculatory Dysfunction via Targeted AQP4 Inhibition While Preserving the Glymphatic System. | ||
J Ethnopharmacol Exploring the Neuroprotective Properties of Musk against High-altitude Cerebral Edema: Unveiling the Mechanisms via TNF-α/RIPK1 Pathway Regulation and Necroptosis Inhibition | ||
Int J Mol Sci Ligustrazine hydrochloride Prevents Ferroptosis by Activating the NRF2 Signaling Pathway in a High-Altitude Cerebral Edema Rat Model | ||
Front Pharmacol Eleutheroside B alleviates oxidative stress and neuroinflammation by inhibiting the JAK2/STAT3 signaling pathway in a rat high altitude cerebral edema model |
