Aquaporin 4 Monoclonal antibody, PBS Only

• 

  WB analysis using 68448-1-Ig (same clone as 68448-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68448-1-Ig (AQP4 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68448-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat spinal cord using 68448-1-Ig (same clone as 68448-1-PBS)

  rat spinal cord tissue were subjected to SDS PAGE followed by western blot with 68448-1-Ig (AQP4 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68448-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 68448-1-Ig (same clone as 68448-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 68448-1-Ig (Aquaporin 4 antibody) at dilution of 1:4000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68448-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 68448-1-Ig (same clone as 68448-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 68448-1-Ig (Aquaporin 4 antibody) at dilution of 1:4000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68448-1-PBS in a different storage buffer formulation.

Aquaporin 4 Monoclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 68448-1-PBS

Clone No.3G7D3

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat, pig, rabbit

Applications

WB, IHC, Indirect ELISA

Synonyms

AQP4, Aquaporin-4, Aquaporin4, AQP-4, AQP 4

---

Product Information

68448-1-PBS targets Aquaporin 4 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.

• Tested Reactivity: human, mouse, rat, pig, rabbit
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9830

  Product name: Recombinant human AQP4 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 208-323 aa of BC022286

  Sequence: TGASMNPARSFGPAVIMGNWENHWIYWVGPIIGAVLAGGLYEYVFCPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVLSSV

• Full Name: Aquaporin 4
• Calculated Molecular Weight: 323 aa, 35 kDa
• Observed Molecular Weight: 35-37 kDa
• GenBank Accession Number: BC022286
• Gene Symbol: Aquaporin 4
• Gene ID (NCBI): 361
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P55087
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Aquaporins are specialized water transport channels in plasma membranes of water-permeable tissues. Aquaporin-4 (AQP4) is the most abundant water channel in the human central nervous system and is important to fluid movements in brain. Aquaporin-4 exists as two isoforms, a long (M1) isoform with translation initiation at Met-1, and a shorter (M23) isoform with translation initiation at Met-23, with molecular weights around 35-37 kDa and 32-34 kDa, respectively.