Tested Applications
| Positive WB detected in | COLO 320 cells, HEK-293 cells, MCF-7 cells, U-87 MG cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
83322-3-RR targets AQP6 in WB, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag26845 Product name: Recombinant human AQP6 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 221-282 aa of NM_001652 Sequence: MLMGALLASLIYNFVLFPDTKTLAQRLAILTGTVEVGTGAGAGAEPLKKESQPGSGAVEMESV Predict reactive species |
| Full Name | aquaporin 6, kidney specific |
| Calculated Molecular Weight | 29 kDa |
| Observed Molecular Weight | 34 kDa |
| GenBank Accession Number | NM_001652 |
| Gene Symbol | AQP6 |
| Gene ID (NCBI) | 363 |
| RRID | AB_3670988 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purfication |
| UNIPROT ID | Q13520 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
AQP6 (Aquaporin-6) has recently been identified as an intracellular vesicle water channel with anion permeability that is activated by low pH or HgCl2 (PMID: 12034750). It could be involved in physiological mechanisms of fluid movement, acid-base regulation, and/or anion transport. The calculated MW of AQP6 is 29 kDa, but the actual observed MW is around 35 kDa, which represents glycosylated AQP6 monomer forms (PMID: 19811639).
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for AQP6 antibody 83322-3-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |





