AQP6 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 83322-3-RR (same clone as 83322-3-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 83322-3-RR (AQP6 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83322-3-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83322-3-RR

  Biolayer interferometry (BLl) kinetic assays of 83322-3-RR against Human AQP6 were performed. The affinity constant is 0.749 nM.

AQP6 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 83322-3-PBS

Clone No.240175F9

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

Aquaporin6, Aquaporin 6, AQP 6, 240175F9

---

Product Information

83322-3-PBS targets AQP6 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag26845

  Product name: Recombinant human AQP6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 221-282 aa of NM_001652

  Sequence: MLMGALLASLIYNFVLFPDTKTLAQRLAILTGTVEVGTGAGAGAEPLKKESQPGSGAVEMESV

• Full Name: aquaporin 6, kidney specific
• Calculated Molecular Weight: 29 kDa
• Observed Molecular Weight: 34 kDa
• GenBank Accession Number: NM_001652
• Gene Symbol: AQP6
• Gene ID (NCBI): 363
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q13520
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

AQP6 (Aquaporin-6) has recently been identified as an intracellular vesicle water channel with anion permeability that is activated by low pH or HgCl2 (PMID: 12034750). It could be involved in physiological mechanisms of fluid movement, acid-base regulation, and/or anion transport. The calculated MW of AQP6 is 29 kDa, but the actual observed MW is around 35 kDa, which represents glycosylated AQP6 monomer forms (PMID: 19811639).