ARMCX1 Polyclonal antibody, PBS Only

• 

  WB analysis of mouse ovary using 20193-1-AP (same clone as 20193-1-PBS)

  mouse ovary tissue were subjected to SDS PAGE followed by western blot with 20193-1-AP (ARMCX1 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20193-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse pancreas using 20193-1-AP (same clone as 20193-1-PBS)

  mouse pancreas tissue were subjected to SDS PAGE followed by western blot with 20193-1-AP (ARMCX1 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20193-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

ARMCX1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 20193-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

20193-1-PBS targets ARMCX1 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14120

  Product name: Recombinant human ARMCX1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 29-230 aa of BC002691

  Sequence: WGRDENEKIWDEDEESTDTSEIGVETVKGAKTNAGAGSGAKLQGDSEVKPEVSLGLEDCPGVKEKAHSGSHSGGGLEAKAKALFNTLKEQASAKAGKGARVGTISGNRTLAPSLPCPGGRGGGCHPTRSGSRAGGRASGKSKGKARSKSTRAPATTWPVRRGKFNFPYKIDDILSAPDLQKVLNILERTNDPFIQEVALVTL

• Full Name: armadillo repeat containing, X-linked 1
• Calculated Molecular Weight: 453 aa, 49 kDa
• Observed Molecular Weight: 49-55 kDa
• GenBank Accession Number: BC002691
• Gene Symbol: ARMCX1
• Gene ID (NCBI): 51309
• RRID: AB_2878656
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9P291
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.