ARMCX1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ARMCX1 Polyclonal antibody (20193-1-AP)

• Featured Product
• KD/KO Validated

ARMCX1 Polyclonal Antibody for WB, ELISA

Cat No. 20193-1-AP Copied!

Publications (6)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF, ELISA

Synonyms

ALEX1, ARMCX1, Protein ALEX1

• 

  WB analysis of mouse ovary using 20193-1-AP

  mouse ovary tissue were subjected to SDS PAGE followed by western blot with 20193-1-AP (ARMCX1 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse pancreas using 20193-1-AP

  mouse pancreas tissue were subjected to SDS PAGE followed by western blot with 20193-1-AP (ARMCX1 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach using 20193-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 20193-1-AP (ARMCX1 antibody) at dilution of 1:500 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for ARMCX1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse ovary tissue, mouse pancreas tissue

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

20193-1-AP targets ARMCX1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, monkey
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14120

  Product name: Recombinant human ARMCX1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 29-230 aa of BC002691

  Sequence: WGRDENEKIWDEDEESTDTSEIGVETVKGAKTNAGAGSGAKLQGDSEVKPEVSLGLEDCPGVKEKAHSGSHSGGGLEAKAKALFNTLKEQASAKAGKGARVGTISGNRTLAPSLPCPGGRGGGCHPTRSGSRAGGRASGKSKGKARSKSTRAPATTWPVRRGKFNFPYKIDDILSAPDLQKVLNILERTNDPFIQEVALVTL

• Full Name: armadillo repeat containing, X-linked 1
• Calculated Molecular Weight: 453 aa, 49 kDa
• Observed Molecular Weight: 49-55 kDa
• GenBank Accession Number: BC002691
• Gene Symbol: ARMCX1
• Gene ID (NCBI): 51309
• RRID: AB_2878656
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9P291
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The ARMCX1 Polyclonal antibody (Cat# 20193-1-AP) has 6 citations published in journals including Nature Cell Biology, Cell Oncology, Biology Direct, Neuroscience, Genesis, and Current Neuropharmacology. Research fields span mitochondrial biology and vesicle biogenesis, cancer (nasopharyngeal carcinoma and lung adenocarcinoma), and neuroscience (traumatic brain injury, vascular dementia, and axon regeneration). Applications cited include WB, IHC, and IF across human, mouse, and monkey species.

Automatically generated from the 6 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
monkey	WB	Nat Cell Biol; MIROs and DRP1 drive mitochondrial-derived vesicle biogenesis and promote quality control.; Authors - Tim König ; KD Validated
human	WB,IHC	Cell Oncol (Dordr); Upregulated ARMCX1 suppresses nasopharyngeal carcinoma progression by promoting TRIM21-mediated β-catenin degradation.; Authors - Zhe Hu ; KD Validated
human	WB,IHC	Biol Direct; ARMCX1 inhibits lung adenocarcinoma progression by recruiting FBXW7 for c-Myc degradation; Authors - Zhe Hu
mouse	WB,IF	Neuroscience; Armcx1 reduces neurological damage via a mitochondrial transport pathway involving Miro1 after traumatic brain injury; Authors - Qiuying Li
mouse	WB	Genesis; Generation of an Armcx1 Conditional Knockout Mouse; Authors - Cora L Bright
		Curr Neuropharmacol; Strychni Semen Improves Spatial Memory and Promotes Axon Regeneration Following Vascular Dementia in Mice.; Authors - Yan Zhang